KEGG   Novosphingobium sp. PP1Y: PP1Y_AT36325Help
Entry
PP1Y_AT36325      CDS       T01515                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:npp00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3812833..3814008)
Genome map
AA seq 391 aa AA seqDB search
MLCACPLSAQANEVEGRRLFVDPKSTTARVAERLTGQARRDALSMARIPSASWFTDGTPE
GVERKVRALVDRAAARREVPVLVAYNIPYRDCALYSAGGAKDGAAYRAWIRGFAKGIGDR
EAIVILEPDGLGVIPWHRTLSGELENCRPDGIDERAADTRFELLRDAVLVLSTLPNVGLY
LDGTGSGWLSPAEASSRLIRADVARADGFFLNVSNYESNARLVPYARWISDCIALVNRGG
LEPRQCPAHEKGVDDDNLAAASARTAAAYNQLFGQLGVARDPALQKRAVIDTSRNGRGGW
LPPQGKYRDAEVWCNPPGRGLGRRPTLESDEAYVDAYLWIKIPGESDGECLRGRGGPADP
ERGVVAPPAGSWFAAQARELVELADPPLIAK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgttatgcgcgtgccccttgtctgcgcaggcaaacgaggtggaggggcgcaggctgttc
gtcgatcccaaaagcacgacggccagggtggcggaacgcctgacaggccaggcacgccgc
gatgccctttcgatggcgcgtattccttcggcatcctggtttaccgacgggacgcccgaa
ggggtcgaacgcaaggttcgtgccctcgtggatcgcgctgccgcgcggcgcgaggtgccg
gtgctcgtggcttacaacatcccctatcgcgactgcgcgctctattctgccgggggcgcg
aaggacggcgcagcctatcgtgcctggattcggggatttgccaagggtatcggcgatcgt
gaggcgatcgtcattctcgagccggacgggctgggcgttattccctggcaccggacgctt
tcgggagagcttgagaattgtcgacccgacggcatcgacgaacgtgccgccgatacgcgc
tttgaactgttgcgcgatgcggttctggttctgtccactctgccgaatgtcggcctctac
ctggatggtacggggagcggctggctgtctcctgcggaagcgtcaagccggctgatacgc
gccgacgtagcgcgggcggatggctttttcctcaatgtctcgaattacgaaagcaatgcc
cgtctggtcccttacgcgcgatggatcagcgattgcatcgcgctggtgaatcggggcggg
ctggagcctcgccagtgtcccgcgcatgaaaaaggggtggacgacgataatctcgccgcc
gcctcggcacgaaccgccgctgcctacaaccagttgttcgggcaactgggagtcgctcgc
gatccggcgcttcagaagcgggcggtgatcgacaccagccgcaacgggcgtggcggttgg
ttgcctccgcagggcaagtaccgggatgcggaggtctggtgcaatccgcccgggcgcggg
ctggggcggcgaccgacgctggagagcgatgaggcctatgtcgatgcctatctctggatc
aagatccccggtgaatcggacggcgaatgtctgcgcgggcggggcggtccagccgacccc
gagcgtggtgtagtcgcgccgcctgcggggtcctggttcgcagctcaggcgcgggaactc
gtcgaacttgcagatccgccactgatcgcgaagtag

DBGET integrated database retrieval system