KEGG   Novosphingobium sp. PP1Y: PP1Y_AT37184Help
Entry
PP1Y_AT37184      CDS       T01515                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
npp  Novosphingobium sp. PP1Y
Brite
Enzymes [BR:npp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PP1Y_AT37184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3899773..3900387
Genome map
AA seq 204 aa AA seqDB search
MTLTEDRSAPSAQNSVSAARRAMITSQLRTSGVNEPWVLAAMAGIAREDFVPDTMRDAAY
IDRAIPLGNGRSLAAPLVQAKMLAEAEPTAQDKALLIGDGAGYLAALLRPLVGSLDAVDP
AEAGAMAGEGGYTLVVIDGAIEELPAGIAAQLAEDGRIVTGLMVRGVSRLASGRKAAGVV
SLLPLAEIGIPALPELAAPKRWSF
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgaccgaggatcggtccgccccatccgcccagaattccgtgagcgcggcccgt
cgcgccatgatcaccagccagctgcgcaccagcggggtcaacgagccctgggtgcttgcg
gcaatggccggcatcgcccgcgaggacttcgttcccgataccatgcgcgatgccgcctat
atcgaccgtgcgatcccgctcggcaatggccgctcgctcgccgcgccgctggtgcaagcg
aagatgctggccgaggccgaacccaccgcccaggacaaggcgctgctcatcggcgacggt
gccggctaccttgccgcgctgctgcgtccgctggtcggttcgctcgacgccgtcgacccg
gccgaagccggcgcgatggcgggtgagggcggttatacgctggtcgtgatcgacggtgcg
atcgaggaactgcctgccggcatcgccgcccagcttgccgaagacggccgcatcgtcacc
ggcctcatggtgcgcggcgtctcgcgcctcgcgtcgggccgcaaggccgctggcgtcgtg
tcgctgctcccgctcgctgaaatcggcattcctgcgctccccgaactggcggctccgaaa
cgctggagcttctga

DBGET integrated database retrieval system