KEGG   Novosphingobium sp. PP1Y: PP1Y_AT433Help
Entry
PP1Y_AT433        CDS       T01515                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PP1Y_AT433
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PP1Y_AT433
   00640 Propanoate metabolism
    PP1Y_AT433
   00660 C5-Branched dibasic acid metabolism
    PP1Y_AT433
Enzymes [BR:npp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PP1Y_AT433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
44019..45218
Genome map
AA seq 399 aa AA seqDB search
MNIHEYQAKELLAKYGVGIPAGIAALTVEEAVAAAKQLPGPLYVVKAQIHAGGRGKGKFK
ELGPDAKGGVRLAKSIEEVEAFAKEMLGNTLVTVQTGEAGKQVNRLYVTDGVDIAKEYYF
SMLVDRASGRVAMIASTEGGMDIEEVAHSTPEKITTVTIDPAEGFQPHHGRAVAYALKLD
GDLNKQAQKIAKQIYEAFMALDCDMLEINPLVETKDGQLLVLDTKMSFDSNALYRHPDVF
ALRDETEEDPAEIEASKYDLAYIKLDGDIGCMVNGAGLAMATMDIIKLNGSFPANFLDVG
GGATTEKVTAAFKIILKDPNVKGILVNIFGGIMKCDVIAEGIVAAAKEVNLGVPLVVRLE
GTNVQQGKDILANSGLPIVPANDLGDAAKKIVAEVKSAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcacgaatatcaggcgaaggaactgcttgcgaagtatggcgtgggcattccc
gccggcatcgccgctctcacggtcgaagaagcggttgccgccgccaagcagctgcctggt
ccgctttatgtcgtgaaggcccagatccacgccggtgggcgcggcaagggcaagttcaag
gaactcggccccgacgcgaagggcggcgttcgccttgccaagtcgatcgaggaagtcgaa
gccttcgccaaggaaatgctcggcaacaccctcgtcaccgtgcagaccggtgaagctggc
aagcaggtcaaccgtctctacgtgaccgacggcgtcgacatcgccaaggaatactacttc
tcgatgctcgtcgaccgtgcctcgggccgcgtcgcgatgatcgcctcgaccgaaggcggc
atggacatcgaggaagtcgcgcactcgactcccgaaaagatcaccaccgtcacgatcgac
cccgccgaaggcttccagccgcaccacggccgcgcggtagcctatgcgctcaagctggac
ggtgacctcaacaagcaggcccagaagatcgccaagcagatctacgaggccttcatggcg
ctcgattgcgacatgctcgagatcaatccgctggtcgaaaccaaggacggccagctgctc
gtcctcgacaccaagatgagcttcgactcgaacgccctttaccgtcaccccgacgtcttc
gccctgcgcgacgagaccgaagaagacccggccgagatcgaagcgagcaagtacgacctc
gcctacatcaagctcgacggcgacatcggctgcatggtcaacggcgcgggccttgccatg
gcgacgatggacatcatcaagctcaacggctcgttcccggccaacttcctcgacgtgggc
ggcggcgccaccaccgagaaggtgactgcggcattcaagatcattctcaaggaccccaac
gtgaagggcatcctcgtgaacatcttcggcggcatcatgaagtgcgacgtcatcgcggaa
ggcatcgtcgctgcggccaaggaagtgaacctgggcgtgccgctcgtggttcgcctcgaa
ggcaccaacgtccagcagggcaaggacatcctggccaactcgggcctgccgatcgtcccc
gccaacgacctgggcgatgcagccaagaagatcgtcgcggaagtgaagagtgccgcctga

DBGET integrated database retrieval system