KEGG   Novosphingobium sp. PP1Y: PP1Y_AT4801Help
Entry
PP1Y_AT4801       CDS       T01515                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PP1Y_AT4801
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PP1Y_AT4801
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PP1Y_AT4801
Enzymes [BR:npp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PP1Y_AT4801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
506404..507807
Genome map
AA seq 467 aa AA seqDB search
MDYISTRGSAPALDFEGATLAGLASDGGLYVPREWPRFSQDEIAAMAGLPYAQLAAKIMF
PFVEGSLTHERLLELTSEAYGRFAHKAVTPLKQFDEQQWLLELFHGPTLAFKDVALQLLG
LLFEEFLSRSERNLTIVGATSGDTGSAAIDAVAGRAKVDIFMLHPKGRVSDVQRRQMTTV
LAPNVHNLALEDASFDDAQAIVKRMFNDKGMTDRFAIGAVNSINWARLMAQVVYYFAAGL
QLGAPHRKVAFSVPTGNFGDVFAGYVAAQMGLPIEKLIVATNVNDILHRALANGDYSQGT
VTPTAAPSMDIQVSSNFERLLFDLGGRDGKALAEQMAGFESTKAMQLTNAQREGAAALFQ
SARADADEMASTIRWAWENCGELIDPHTACGLFAARNSGIDGSIPVVTLATAHPAKFPEA
VERATGHRPGLPERVGDLFEREERSTSLPGSFEAVAEFVAQHAAPKV
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggactacatcagcactcgcggcagcgctccggcgctcgatttcgaaggcgcaacgctc
gccggtctcgcttcggacggcggcctctacgtgccgcgcgaatggccgcgcttctcgcag
gacgagatcgccgccatggcgggccttccttatgcgcagctggccgcgaagatcatgttc
cccttcgtcgaaggcagcctcacccatgagcgcctgctcgaactgacgagcgaggcttac
ggccgcttcgcccacaaggcggtgacgccgctcaagcagttcgacgaacagcagtggctg
ctggaactgttccacggccccacgctcgcgttcaaggacgtggcgctgcaactgctcggc
ctgctcttcgaggagttcctctcgcgctccgaacgcaacctgacgatcgtcggcgcgact
tcgggcgacaccggctcggccgccatcgatgccgtcgctggccgcgccaaggtcgacatc
ttcatgctgcaccccaagggccgcgtgtccgacgtgcagcgccgccagatgacgacggtg
ctggcgcccaacgtccacaacctcgcgcttgaagatgccagcttcgacgatgcccaggcg
atcgtgaagcgcatgttcaacgacaagggcatgaccgaccgattcgccatcggcgcggtc
aactcgatcaactgggcacgcctgatggcgcaggtggtgtattacttcgcggccgggctg
cagcttggcgcaccgcaccgcaaggtcgccttctcggtcccgaccggcaatttcggcgat
gtcttcgccggctatgtcgcggcgcagatgggcctgccgatcgagaagctgatcgtggcc
accaacgtgaacgacattctccaccgcgcgcttgccaatggcgattattcgcagggcacg
gtgacgcccaccgcggcgccttcgatggacattcaggtctcttcgaacttcgaacgcctg
ctgttcgacctgggcggacgcgacggcaaggcgctggccgagcagatggccggcttcgaa
tcgaccaaggcgatgcagctgaccaatgcgcagcgcgaaggggccgcggcgctgttccag
tccgcgcgtgccgatgccgacgagatggcctcgacgatccgctgggcctgggagaattgc
ggcgagctgatcgatccgcacaccgcctgcggccttttcgccgcacgcaactcgggtatc
gacggctcgatcccggtcgttacgctggcaaccgcgcacccggccaagttccccgaagcg
gtcgagcgcgccaccgggcaccgcccgggcctgcccgagcgtgtgggcgacctgttcgag
cgcgaggagcgctccacgtcgctgcccggctcgttcgaggcggttgccgaattcgtcgcc
cagcacgccgcgcccaaggtctga

DBGET integrated database retrieval system