KEGG   Novosphingobium sp. PP1Y: PP1Y_AT4801Help
Entry
PP1Y_AT4801       CDS       T01515                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00260  Glycine, serine and threonine metabolism
npp00750  Vitamin B6 metabolism
npp01100  Metabolic pathways
npp01110  Biosynthesis of secondary metabolites
npp01120  Microbial metabolism in diverse environments
npp01230  Biosynthesis of amino acids
Module
npp_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PP1Y_AT4801
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PP1Y_AT4801
Enzymes [BR:npp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PP1Y_AT4801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: CCA91440
UniProt: F6IHI9
Position
506404..507807
Genome map
AA seq 467 aa AA seqDB search
MDYISTRGSAPALDFEGATLAGLASDGGLYVPREWPRFSQDEIAAMAGLPYAQLAAKIMF
PFVEGSLTHERLLELTSEAYGRFAHKAVTPLKQFDEQQWLLELFHGPTLAFKDVALQLLG
LLFEEFLSRSERNLTIVGATSGDTGSAAIDAVAGRAKVDIFMLHPKGRVSDVQRRQMTTV
LAPNVHNLALEDASFDDAQAIVKRMFNDKGMTDRFAIGAVNSINWARLMAQVVYYFAAGL
QLGAPHRKVAFSVPTGNFGDVFAGYVAAQMGLPIEKLIVATNVNDILHRALANGDYSQGT
VTPTAAPSMDIQVSSNFERLLFDLGGRDGKALAEQMAGFESTKAMQLTNAQREGAAALFQ
SARADADEMASTIRWAWENCGELIDPHTACGLFAARNSGIDGSIPVVTLATAHPAKFPEA
VERATGHRPGLPERVGDLFEREERSTSLPGSFEAVAEFVAQHAAPKV
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggactacatcagcactcgcggcagcgctccggcgctcgatttcgaaggcgcaacgctc
gccggtctcgcttcggacggcggcctctacgtgccgcgcgaatggccgcgcttctcgcag
gacgagatcgccgccatggcgggccttccttatgcgcagctggccgcgaagatcatgttc
cccttcgtcgaaggcagcctcacccatgagcgcctgctcgaactgacgagcgaggcttac
ggccgcttcgcccacaaggcggtgacgccgctcaagcagttcgacgaacagcagtggctg
ctggaactgttccacggccccacgctcgcgttcaaggacgtggcgctgcaactgctcggc
ctgctcttcgaggagttcctctcgcgctccgaacgcaacctgacgatcgtcggcgcgact
tcgggcgacaccggctcggccgccatcgatgccgtcgctggccgcgccaaggtcgacatc
ttcatgctgcaccccaagggccgcgtgtccgacgtgcagcgccgccagatgacgacggtg
ctggcgcccaacgtccacaacctcgcgcttgaagatgccagcttcgacgatgcccaggcg
atcgtgaagcgcatgttcaacgacaagggcatgaccgaccgattcgccatcggcgcggtc
aactcgatcaactgggcacgcctgatggcgcaggtggtgtattacttcgcggccgggctg
cagcttggcgcaccgcaccgcaaggtcgccttctcggtcccgaccggcaatttcggcgat
gtcttcgccggctatgtcgcggcgcagatgggcctgccgatcgagaagctgatcgtggcc
accaacgtgaacgacattctccaccgcgcgcttgccaatggcgattattcgcagggcacg
gtgacgcccaccgcggcgccttcgatggacattcaggtctcttcgaacttcgaacgcctg
ctgttcgacctgggcggacgcgacggcaaggcgctggccgagcagatggccggcttcgaa
tcgaccaaggcgatgcagctgaccaatgcgcagcgcgaaggggccgcggcgctgttccag
tccgcgcgtgccgatgccgacgagatggcctcgacgatccgctgggcctgggagaattgc
ggcgagctgatcgatccgcacaccgcctgcggccttttcgccgcacgcaactcgggtatc
gacggctcgatcccggtcgttacgctggcaaccgcgcacccggccaagttccccgaagcg
gtcgagcgcgccaccgggcaccgcccgggcctgcccgagcgtgtgggcgacctgttcgag
cgcgaggagcgctccacgtcgctgcccggctcgttcgaggcggttgccgaattcgtcgcc
cagcacgccgcgcccaaggtctga

DBGET integrated database retrieval system