KEGG   Novosphingobium sp. PP1Y: PP1Y_AT6273Help
Entry
PP1Y_AT6273       CDS       T01515                                 

Definition
putative acyl-CoA thioesterase I protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PP1Y_AT6273
Enzymes [BR:npp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PP1Y_AT6273
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PP1Y_AT6273
Lipid biosynthesis proteins [BR:npp01004]
 Fatty acid synthase
  Component type
   PP1Y_AT6273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
665228..665878
Genome map
AA seq 216 aa AA seqDB search
MGPERPILAFGDSLLAGYGLNDGESYPDRLEQALRARGINARVINAGVSGDTTEAGLERL
DFTLSSQKEKPELVIISLGGNDMLRGLPPATTRNNLEAILQRLKQENIKVVLLGMLAAPN
LGKDYAAKFNPIYAQLSEKYDAALVPFFLQPVIDKPDLMQPDHMHPTALGVDAIVTATVD
DVADALPTGAEAEASEAASDVAVPPTASAGEERMAR
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggggccggagcgcccgatcctggccttcggggattcgctgcttgccggatacggtctc
aacgatggcgagagctatcctgaccggctcgaacaggccctgcgcgcgcgcggcatcaac
gcaagggtcatcaatgcgggcgtttcgggcgatacgaccgaggcagggctggagcggctc
gacttcacgctgagcagccagaaggaaaagccggagctggtcatcatcagcctgggcgga
aacgacatgctgcgcggactgcctccggcgacgacacgcaacaacctcgaggcgatcctg
cagcgcctcaagcaggaaaacatcaaggtcgtcctgcttggcatgcttgccgcgccgaac
ctgggcaaggactacgcggcgaaattcaacccgatctatgcgcagctctcggagaagtac
gacgcggcactggtgcccttcttcctccagccggtgatcgacaagccggacctgatgcag
ccggaccacatgcatccgactgcgctgggcgtcgacgccatcgtgaccgccacggtcgac
gacgtggccgatgccctgccgaccggtgcggaagccgaagcctccgaagcggcatcggac
gtggcggtgccgccaaccgcctcggccggagaggagcggatggcgcgctga

DBGET integrated database retrieval system