KEGG   Novosphingobium sp. PP1Y: PP1Y_AT710Help
Entry
PP1Y_AT710        CDS       T01515                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PP1Y_AT710
   01230 Biosynthesis of amino acids
    PP1Y_AT710
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PP1Y_AT710
  Energy metabolism
   00680 Methane metabolism
    PP1Y_AT710
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PP1Y_AT710
Enzymes [BR:npp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PP1Y_AT710
Exosome [BR:npp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PP1Y_AT710
  Exosomal proteins of melanoma cells
   PP1Y_AT710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(76632..77324)
Genome map
AA seq 230 aa AA seqDB search
MPRLILVRHGQSQWNLENRFTGWWDVDLTEKGEAEARAAGALLKEKGILPTVAFTSLQTR
AIKTLHFALEAAGILWIPETKDWRLNERHYGGLTGLDKAETAARHGEDQVKIWRRSFDTP
PPVLERGSEFDLSSDPRYAGIDVPQTESLKDTIARVLPYYQSSIVPHLRTSSDATVIVSA
HGNSLRALVKHLSNISDEEITGLEIPTGQPIVYDLDTDLNVVDRYYLSER
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
ttgcctcgcctgatcctcgttcgccacggccagagccaatggaatctcgagaaccgtttc
accggctggtgggacgtcgacctcaccgagaaaggcgaagcagaggcccgagcggccggc
gcgctgctgaaggaaaagggcatcctgccgaccgtcgcgttcacctcgctgcagacccgc
gcgatcaagacgctgcacttcgcgctggaggccgcgggcatcctgtggatcccggaaacc
aaggactggcgcctcaatgagcgtcactacggcggactcaccggcctcgacaaggccgag
accgcggccaggcacggcgaggaccaggtgaagatctggcgccgcagcttcgatacgccg
ccgccggtcctcgaacgcggcagcgagttcgacctgtcctccgacccgcgctatgccgga
atcgacgtgccgcagaccgagagcctcaaggacaccatcgcgcgcgtcctgccctattac
cagagctcgatcgtcccgcacctgcggacgagctcggatgccaccgtgatcgtttcggcc
cacggcaattccctgcgcgcgctggtgaagcacctctccaacatctcggacgaggaaatc
accggactggaaatcccgaccggccagccgatcgtctacgacctcgacaccgacctcaac
gtggtcgaccgttactacctgtcggagcgttga

DBGET integrated database retrieval system