KEGG   Novosphingobium sp. PP1Y: PP1Y_AT752Help
Entry
PP1Y_AT752        CDS       T01515                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PP1Y_AT752
   00052 Galactose metabolism
    PP1Y_AT752
   00500 Starch and sucrose metabolism
    PP1Y_AT752
   00520 Amino sugar and nucleotide sugar metabolism
    PP1Y_AT752
Enzymes [BR:npp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PP1Y_AT752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(82681..83562)
Genome map
AA seq 293 aa AA seqDB search
MSDNNFRKPVRKAVFPVAGLGTRFLPATKAIPKELLPVVDRPLIQYAVDEAREAGIEEFV
FVTGRGKTAIVEHFDTAYELEATMNSRGKSLDPLDPTRIQPGNLVTVRQQVPMGLGHAIW
CARAVVGDEPFAIFLPDELMYGSPGCMAQMVEAYNKVGGNLVSVIEVPHEEVSSYGVIAP
GESKGNLTEVKGLVEKPRAEDAPSNKIVSGRYILQPEIMGLLANQGKGAGGEIQLTDSMA
KLIGEQPFHAVTFDGRRFDCGSKVGFVEATLAIALDREDMGAEVRSMMQAMLG
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacaacaatttccgcaagcccgtccgcaaggccgtctttcctgttgccggtctg
ggcacgcgcttcctgcccgccaccaaggcgatccccaaggaactgcttccggtggtcgat
cgcccgctgatccagtacgccgtggatgaggcgcgcgaggcggggatcgaggagttcgtc
ttcgtcacaggtcgcggcaagaccgcgatcgtggagcatttcgataccgcctacgaactg
gaagcgacgatgaattcgcgcggaaaatcgctcgatccgctggatccgacgcgcatccag
ccgggtaatctggtcaccgtgcgccagcaggtgccgatgggactgggccacgcgatctgg
tgcgcgcgcgccgtcgtcggcgacgagcccttcgcgatcttcctccccgacgagctgatg
tacggctcacccggctgcatggcgcagatggtcgaggcctacaacaaggtcggcggcaac
ctcgtctcggtgatcgaggtcccgcatgaggaagtctcgagctacggcgtcatcgcgccg
ggcgaaagcaagggcaaccttaccgaagtgaagggcctcgtggagaagcccagggcagaa
gacgccccttcgaacaagatcgtctccggccgctacatcctccagcccgagatcatgggc
ctgctcgccaaccagggcaaaggtgcaggcggcgaaatccagctgaccgattcgatggcc
aagctgatcggcgaacagcctttccacgccgtgactttcgatggccgccgcttcgactgc
ggatcgaaggtcggcttcgtcgaagcgaccctcgccatcgcgctcgaccgtgaggacatg
ggcgccgaagtgcgctcgatgatgcaggccatgctcggctga

DBGET integrated database retrieval system