KEGG   Novosphingobium sp. PP1Y: PP1Y_AT7604Help
Entry
PP1Y_AT7604       CDS       T01515                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PP1Y_AT7604
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PP1Y_AT7604
Enzymes [BR:npp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PP1Y_AT7604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
815425..816555
Genome map
AA seq 376 aa AA seqDB search
MPISRLFDLSDKSHAPRLVLKVGSALLVGKQGVRREWLTGLVAEIAAARARGQQVIVVSS
GAIALGAATLGLDKGGRGSLADAQAAAAVGQIALSGLWAELLGSHGLTAAQMLLTLEDLE
DRRRYLNVTATLTRLLDAGAVPVINENDSVATNEIRFGDNDRLAARVAQAAQASAVLLLS
DIDGLYDRHPKEPGAKMIPVVEGVTAEVHAMASAESNSGMGSGGMISKLQAAEIAELAGI
ALVIGNGQHDRPVARIVDEGVGTLFLPRRKAGARKAWLGGRLRLKGSIIVDDGAAAALLR
GSSLLAKGITGVSGAFLRGDPVAIEDGQGRVLAHGLSEYDAAECEQIRGHHSSEQADILG
YAPRSSVVHRDQLVLK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcccatttcccgcctgttcgatctttcagacaagtcccatgcgcctcgcctcgttctc
aaggtgggatcggcgctgcttgtcgggaagcaaggcgtgcggcgcgaatggctgacgggc
ctcgtcgccgaaatcgccgcggcccgcgcgcgtggccagcaggtgatcgttgtttcctcg
ggcgcgatcgcgctgggtgcggcgacgctgggcctcgacaagggcggccgcggctcgctg
gccgacgcgcaggccgcggctgcggtcgggcagatcgcgctttcggggctatgggccgaa
ctgctcggcagccatggcctcactgccgcgcagatgctgctgacgctggaggaccttgag
gaccgccgccgttatctcaacgtcaccgccacgctcacgcgcctgctggatgccggggcg
gtgccggtgatcaacgagaacgattcggtcgccaccaacgagatccgcttcggtgacaac
gaccgcctcgccgcgcgcgtggcgcaggcggcgcaggcaagtgcagtcctgctgctctcc
gacatcgatggcctgtacgaccggcacccgaaggagccgggcgcgaagatgatcccggtg
gtggagggcgtgacggccgaagtccacgccatggccagcgcggaatcgaattccggcatg
ggctcgggcggcatgatctcgaagctgcaggcggccgagatcgccgaactggccgggatc
gcattggtcatcggcaacgggcagcatgaccgaccggtggcgcggattgtcgacgaaggc
gtgggcacgctgttcctgccgcggcgcaaggccggcgcgcgcaaggcctggctgggcggt
cgcctgcgcctcaagggcagcatcatcgtcgacgatggcgcggcggcggcgctgctgcgg
ggatcgagcctgctcgccaagggcatcaccggggtgagcggcgctttcctgcgcggcgat
ccggtggctatcgaggacgggcagggccgggttctggcccacggcctgtcggaatacgac
gcggccgaatgtgagcagatccgcggccatcattcgagcgagcaggccgacattctcggc
tatgcgccgcgttcctccgtggtccatcgcgaccagctggtgctgaaatga

DBGET integrated database retrieval system