KEGG   Novosphingobium sp. PP1Y: PP1Y_AT7604Help
Entry
PP1Y_AT7604       CDS       T01515                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00330  Arginine and proline metabolism
npp00332  Carbapenem biosynthesis
npp01100  Metabolic pathways
npp01130  Biosynthesis of antibiotics
npp01230  Biosynthesis of amino acids
Module
npp_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PP1Y_AT7604
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PP1Y_AT7604
Enzymes [BR:npp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PP1Y_AT7604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA IF3_N
Motif
Other DBs
NCBI-ProteinID: CCA91698
UniProt: F6IJ72
Position
815425..816555
Genome map
AA seq 376 aa AA seqDB search
MPISRLFDLSDKSHAPRLVLKVGSALLVGKQGVRREWLTGLVAEIAAARARGQQVIVVSS
GAIALGAATLGLDKGGRGSLADAQAAAAVGQIALSGLWAELLGSHGLTAAQMLLTLEDLE
DRRRYLNVTATLTRLLDAGAVPVINENDSVATNEIRFGDNDRLAARVAQAAQASAVLLLS
DIDGLYDRHPKEPGAKMIPVVEGVTAEVHAMASAESNSGMGSGGMISKLQAAEIAELAGI
ALVIGNGQHDRPVARIVDEGVGTLFLPRRKAGARKAWLGGRLRLKGSIIVDDGAAAALLR
GSSLLAKGITGVSGAFLRGDPVAIEDGQGRVLAHGLSEYDAAECEQIRGHHSSEQADILG
YAPRSSVVHRDQLVLK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcccatttcccgcctgttcgatctttcagacaagtcccatgcgcctcgcctcgttctc
aaggtgggatcggcgctgcttgtcgggaagcaaggcgtgcggcgcgaatggctgacgggc
ctcgtcgccgaaatcgccgcggcccgcgcgcgtggccagcaggtgatcgttgtttcctcg
ggcgcgatcgcgctgggtgcggcgacgctgggcctcgacaagggcggccgcggctcgctg
gccgacgcgcaggccgcggctgcggtcgggcagatcgcgctttcggggctatgggccgaa
ctgctcggcagccatggcctcactgccgcgcagatgctgctgacgctggaggaccttgag
gaccgccgccgttatctcaacgtcaccgccacgctcacgcgcctgctggatgccggggcg
gtgccggtgatcaacgagaacgattcggtcgccaccaacgagatccgcttcggtgacaac
gaccgcctcgccgcgcgcgtggcgcaggcggcgcaggcaagtgcagtcctgctgctctcc
gacatcgatggcctgtacgaccggcacccgaaggagccgggcgcgaagatgatcccggtg
gtggagggcgtgacggccgaagtccacgccatggccagcgcggaatcgaattccggcatg
ggctcgggcggcatgatctcgaagctgcaggcggccgagatcgccgaactggccgggatc
gcattggtcatcggcaacgggcagcatgaccgaccggtggcgcggattgtcgacgaaggc
gtgggcacgctgttcctgccgcggcgcaaggccggcgcgcgcaaggcctggctgggcggt
cgcctgcgcctcaagggcagcatcatcgtcgacgatggcgcggcggcggcgctgctgcgg
ggatcgagcctgctcgccaagggcatcaccggggtgagcggcgctttcctgcgcggcgat
ccggtggctatcgaggacgggcagggccgggttctggcccacggcctgtcggaatacgac
gcggccgaatgtgagcagatccgcggccatcattcgagcgagcaggccgacattctcggc
tatgcgccgcgttcctccgtggtccatcgcgaccagctggtgctgaaatga

DBGET integrated database retrieval system