KEGG   Novosphingobium sp. PP1Y: PP1Y_AT8497Help
Entry
PP1Y_AT8497       CDS       T01515                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00230  Purine metabolism
npp01100  Metabolic pathways
Module
npp_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PP1Y_AT8497
Enzymes [BR:npp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PP1Y_AT8497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 Thymidylate_kin AAA_16
Motif
Other DBs
NCBI-ProteinID: CCA91782
UniProt: F6IJF6
Position
complement(911094..911696)
Genome map
AA seq 200 aa AA seqDB search
MFIMSSPSGAGKTTISRMLLERDEHICMSVSCTTRPPRPGEVDGKDYHFVSQAEFDRMVA
DEEFLEWATVFGNSYGTPKAQVKAGLKEGQDYLFDIDWQGTQQLYQKLERDVVRVFLLPP
SIDELRRRLTGRGTDSEDVIAARMERARSEISHWDGYDYVVVNDDIDACFDKVREILAAE
RMRRARQTGLIGFVRELMTP
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgttcatcatgtcctcgccctcgggcgccggcaagacgacgatttcgcgcatgctgctc
gaacgtgacgagcacatctgcatgtcggtttcgtgcaccacccgcccgccgcgcccgggc
gaagtcgatggcaaggactaccatttcgtcagtcaggcagagttcgaccgcatggtcgcc
gacgaggaattcctcgaatgggccacggtgttcggcaacagctacggcacccccaaggca
caagtgaaggcggggctgaaggaaggacaggactacctgttcgacatcgactggcaaggc
acgcagcagctttaccagaagctggagcgcgacgtcgtgcgcgtattcctgctgccgccc
agcatcgacgaactgcgccgtcgactgaccgggcgcggcaccgacagcgaggacgtgatc
gccgcgcgcatggaacgcgcccgttccgagatcagccactgggacggctacgactacgtc
gtcgtcaacgacgatatcgacgcctgcttcgacaaggtgcgcgagatcctggccgccgaa
cggatgcgccgcgcccgccagaccggcctgatcggcttcgttcgcgaactgatgacgccc
tga

DBGET integrated database retrieval system