KEGG   Novosphingobium sp. PP1Y: PP1Y_AT9467Help
Entry
PP1Y_AT9467       CDS       T01515                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PP1Y_AT9467
Enzymes [BR:npp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PP1Y_AT9467
Peptidases [BR:npp01002]
 Cysteine Peptidases
  Family C44
   PP1Y_AT9467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1016464..1018392)
Genome map
AA seq 642 aa AA seqDB search
MCGIAGLWSPGGYSDNTPKLAEKMADRLYHRGPDGRGFHFDPDHGLAMIHTRLSIIGLNA
GDQPIFDKDAGLVLTANGEFYDYKRLRGLLRTDGFEFTTKSDSEIALKLYRKHGFDFLEQ
LRGEFAFAIFDEKKEQLILVRDRFGIRPLFWHNGPNGFFWGSEMKAMLAHPDVPREVCPK
AQLHQMMQVMVPGMTLYKDIQAVLPGHMLIVTRKGDGFEVEQKRYWDAEFPLDGHHDIRS
DDEHIEAVREKLVESITFRLEADVPVACYLSGGIDSCSILGMAAAIQQSPVKAFTISFDD
DRYDEAHIATEMAEKVGADQDILRVKAEDLYGKNFEDAVMFSERTFYNTLGVAKMLMSKH
VRDVGYKVVITGEGSDELFGGYAQFKADLFLHDPDYAATPAAEEMRKRNAIFSGSVLAEE
TISHPAFEEVMGFTPSWIQPWMLTLERVKPLLSDEFKARLGDYDPIAAIAYSLDKSMLDG
RHVLDKVQYSWIKTMLEGQILNWGGDRVDMANSLESRPAFLDHHVAELAMRIPPHVRVRD
GVEKWVVREAMKHVLPEVLYKREKFAFMAPPAHTDVKKAAEIDKLIEKWLSSEKIASHGI
FDEAKMRASIEEYRKSDDHAQNTRKDIILNHAIALHAMEELI
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcattgccggactgtggagccccgggggctactccgacaacaccccgaagctg
gccgagaagatggccgaccgcctctaccaccgcggcccggacgggcgcggcttccatttc
gatccggaccatggcctcgccatgatccacacccgcctctcgatcatcggcctcaatgcc
ggcgaccagccgatcttcgacaaggacgcaggcctcgtcctgaccgccaatggcgagttc
tacgactacaagcgcctgcgcggcctgctgcgcaccgacggcttcgagttcaccaccaag
tccgacagcgagatcgcgctcaagctctaccgcaagcacggcttcgatttcctcgaacag
ctgcgcggcgaattcgctttcgcgatcttcgatgaaaagaaggaacagctgatcctggtg
cgcgaccgcttcgggatccggccgctgttctggcacaacggtcccaatggcttcttctgg
ggcagcgagatgaaggccatgctggcccatcccgacgtgccgcgcgaagtgtgccccaag
gcgcagctgcaccagatgatgcaggtcatggtgccgggcatgacgctatacaaggacatc
caggccgtcctgcccgggcacatgctgatcgtcacccgcaagggcgacggcttcgaggtt
gagcagaagcgctactgggacgccgagttcccgctcgatgggcaccacgacatccgctcg
gacgacgagcacatcgaggccgtgcgcgaaaagctggtggaatccatcaccttcaggctg
gaggctgacgttcccgtggcctgctatctttcaggcggcatcgattcctgctcgatcctg
ggcatggccgcggcgatccagcagtcgccggtcaaggccttcaccatctcgttcgacgac
gaccgctacgacgaggcccatatcgccacggaaatggcggaaaaggtcggcgcggaccag
gacatcctgcgggtcaaggcagaggacctctacggcaagaacttcgaggacgcggtgatg
ttctcggagcgcacgttctacaacacgctgggcgtcgccaagatgctgatgagcaagcac
gtgcgcgacgtcggctacaaggtcgtgatcaccggagaaggctcggacgaactgttcggc
ggctatgcccagttcaaggccgacctgttccttcacgatcccgactatgccgcgacgcct
gcggctgaggagatgcgcaagcgcaatgccatcttctcaggctcggtcctcgcagaagaa
acgatcagccaccccgctttcgaggaagtcatgggtttcacgccgagctggatccagccc
tggatgctcacccttgagcgcgtgaagccgctgctttccgacgagttcaaggcaaggctc
ggcgactacgatcccatcgccgccatcgcttacagcctcgacaagtcgatgcttgatggg
cgccacgtgctcgacaaggtccagtattcctggatcaagaccatgctggaaggccagatc
ctcaactggggcggcgaccgcgtcgacatggccaactcgctggaaagccgcccggccttc
ctcgaccaccacgtggccgaactggccatgcgcatcccgccgcatgtgcgcgtgcgcgac
ggagtcgagaaatgggtcgtgcgcgaggcgatgaagcacgtcctgcccgaagtgctctac
aagcgcgaaaagttcgccttcatggcgcccccggcgcatactgacgtgaagaaggcggcc
gagatcgacaagctgatcgagaagtggctgtcctcggaaaagatcgcctcgcacgggatt
ttcgacgaggcaaagatgcgcgcctcgatcgaggaataccgcaagtccgacgatcatgcg
cagaacacgcgcaaggacatcatcctaaatcacgccatcgcactgcacgcgatggaggag
ctgatctga

DBGET integrated database retrieval system