KEGG   Novosphingobium sp. PP1Y: PP1Y_AT9487Help
Entry
PP1Y_AT9487       CDS       T01515                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PP1Y_AT9487
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PP1Y_AT9487
Enzymes [BR:npp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     PP1Y_AT9487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1018425..1019585)
Genome map
AA seq 386 aa AA seqDB search
MVRRHRAGTGRPAHPRHRAGRDLVTLPASRVDHAPAIVKRPGKIGNCPNPVDFIAKSPKL
KLHVLDQLRGASVLSAAQFDKDLLCELAKFAAYLQLKRFEVGRAMDDKIMAAAFFEPSTR
TRLSFESAMLHLGGKTISVADGKTTGVAKGESMRDIGQMFNSYADVVVVRHTEQSAVSEM
CEYLRVPLLNGGNGSDEHPTQALADWYALLKWRPEIAWASLPEKFRLNIGIIGTPGNMRT
VKSFLMLALLFHENINHITIFSEMADPLGEELRELTKNSPIGIDFSQNLQQSLEYLDVIY
MNAIAYLGDGYRFFGDAFSLNDKSRLKDDTVILHPLARGEELDVSLDDTQHNLYFNQADG
AVWIRQALLLAIFGRVAEVVPAELLA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgccgtcaccgcgctgggactgggcgccctgctcatccgcgacatcgcgcgggg
agagatctggtgaccctgccggcatcgcgggtcgaccacgcccccgccatcgtcaagcgc
ccgggcaagatcggcaattgcccgaacccggtcgacttcatcgcgaaatcgcccaagctc
aagctgcacgtgctggaccagttgcgcggtgcatcggtgctctccgccgcgcagttcgac
aaggacctgctgtgcgaactggccaagttcgcggcctacctgcagctcaagcggttcgaa
gtcggccgtgccatggacgacaagatcatggccgcggcctttttcgaacccagcacccgc
acccggctttccttcgaaagcgccatgctccacctcggcggcaagacgatcagcgtcgcc
gacggcaagaccaccggcgtcgccaagggcgaatcgatgcgcgacatcggccagatgttc
aattcctacgccgacgtcgtcgtggtgcggcataccgagcaatcggccgtgagcgaaatg
tgcgagtacttgcgcgtacccctgctcaacggcggcaacggctccgacgaacatcccacg
caggcgctggccgactggtacgcactgctcaagtggcggcccgagatcgcctgggccagc
ctgccggagaagttccgcctaaacatcggcatcatcggtacgccgggcaacatgcgcacg
gtcaagtcgttcctgatgctggcgctgctgttccacgagaacatcaaccacatcaccatc
ttttccgagatggccgacccgctcggtgaggaactgcgcgaactgacgaagaacagcccg
atcggcatcgacttctcgcagaacctgcaacagagcctcgagtatctcgacgtcatctac
atgaacgccattgcctacctgggcgacggctatcgcttcttcggggatgccttctcgctc
aacgacaagagcaggctgaaggacgacacggtcatcctccacccgctcgcacgcggcgag
gaactcgacgtcagcctcgatgacacccagcacaacctctatttcaatcaggccgacggc
gccgtctggatccgccaggcgttgctgctcgcgatcttcggtcgggtcgcggaagtcgtg
cctgcagaactcctcgcctga

DBGET integrated database retrieval system