KEGG   Novosphingobium sp. PP1Y: PP1Y_AT9804Help
Entry
PP1Y_AT9804       CDS       T01515                                 

Definition
1,4-alpha-glucan branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PP1Y_AT9804
Enzymes [BR:npp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PP1Y_AT9804
Exosome [BR:npp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PP1Y_AT9804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1054517..1056691
Genome map
AA seq 724 aa AA seqDB search
MKPTKSALESLLLGSHADPFSLLGLYSGPTGSFARAILPGADTVEAFSLDGKALGTLDKV
DDRCLFEGELAGKPQPVRYRCSAGEHDWLVTDPYSFGPVLGPLDDLLIAEGTHQRLFDKL
GAHIIDHQGASGVHFAVWAPNARLVSVVGDFNDWDPARHVMRHRKDIGVWEIFIPDIGDY
RAYKYRIVGADGAVQPLKADPFAFMAEIRPKSASMTAHPAKLDWGDEAHRSHWASVDPRK
VPISIYEVHAGSWQRDQWNWFLNWDELADRLIPYVVDMGFTHIEFLPISEHPYDPSWGYQ
TTGLFAPTARFGEPAGFARFVDGAHRAGIGVLLDWVPAHFPTDEHGLVRFDGTALYEHED
PRLGYHPDWNTLIYNFGRREVSSFLVNNALFWAERYHVDGLRVDAVASMLYRDYSRKAGE
WIPNPQGGRENWEAVDFLRATNRALYGTHPGFMTFAEESTAWPGVTQPAYDSAEGERPTA
LGFGFKWNMGFMHDTLQYMSRDAVHRRYHHQDITFGLMYAFSENFVLPLSHDEVVHGKGS
LLNKMSGDDWQKFANLRAYYALMWGYPGKKLLFMGQEFAQRREWSEERALDWELCDAPAH
EGIRNLVKDLNRLYRQKPALHAGDCDAGCFEWLIVDDSQNSVFAWLRKAPGAKPVAVISN
MTPALRSGYRVPLPHEGKWNEILNSDSAHYGGSGKGNLGQVKSEGGAATVTLPPLGTIML
EYAG
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
gtgaagccaacgaagagcgcccttgaatcccttcttctaggttctcacgccgatccattt
tcgttgcttggtctgtattccggtcccactggcagtttcgcgcgggcgatcctgcccggg
gccgatacggtcgaggccttcagtctcgacggcaaggctctcggcacgctcgacaaggtc
gatgaccgctgcctgttcgaaggggaactggcaggcaaaccgcagccggtgcgctaccgc
tgcagcgccggcgagcacgactggctcgtcacagacccctacagcttcgggccggtgctc
ggcccgctcgatgacctgctgatcgcggaaggaacgcaccagcgcctgttcgacaagctg
ggcgctcacatcatcgatcaccagggggcgagcggcgtccactttgcggtctgggcgccc
aatgcccgcctcgtcagcgtggtaggcgatttcaacgattgggaccctgcgcgccatgtc
atgcgtcatcgcaaggacatcggcgtctgggagatcttcattcccgacatcggcgactac
cgcgcctataaataccgcatcgtcggggccgacggcgcggtgcagccgctcaaggccgat
cccttcgccttcatggccgagatccgccccaagagcgcctcgatgacggcgcacccggcc
aagctggactggggcgacgaggcgcatcgttcgcactgggcttcggtcgatccgcgcaag
gtgccgatctcgatctacgaggtccatgccggctcgtggcagcgcgaccagtggaactgg
tttctgaattgggatgaactggccgatcgtctcatcccctatgttgtcgacatgggcttt
acccatatcgagttcctgccgatcagcgagcatccctacgatccctcgtggggctaccag
acgaccggcctgttcgcgccgaccgcgcgcttcggcgaaccggcaggctttgcgcggttt
gtcgacggggcgcaccgcgccggcatcggcgtgctcctcgactgggttccggcgcacttt
cccaccgacgaacatggacttgtccgcttcgacggcaccgcgctttacgagcacgaggac
cccaggctcggctatcatccggactggaacacgctgatctacaatttcggccggcgcgag
gtgtcgagcttccttgtcaacaatgcgctgttctgggccgaacgctaccatgtcgacggg
ctgcgcgtggatgccgtcgcctcgatgctctaccgcgactactcgcgcaaggccggcgaa
tggatacccaacccgcagggcgggcgagagaactgggaagcggtggatttcctgcgcgcc
accaaccgcgcgctttacggcacgcatcccggctttatgacattcgccgaggaatccact
gcatggcccggcgtcacccagcctgcctacgactccgcagaaggggaacggccgaccgcg
ctgggtttcggcttcaagtggaacatgggcttcatgcacgatacgttgcagtacatgagc
cgcgatgccgtgcaccggcgctatcaccatcaggacatcacttttggcctgatgtacgcc
ttcagcgagaacttcgtcctgccgctcagccatgacgaggtcgtccacggcaagggctcg
ctgctcaacaagatgagcggcgacgactggcagaagttcgccaacctgcgtgcctactat
gcgctcatgtgggggtatcccggcaagaagctgctgttcatggggcaggaattcgcccag
cgccgcgaatggagcgaggagcgcgcgctggactgggaactgtgcgacgcccccgcgcac
gaaggcatccgcaatctggtgaaggatctcaatcgcctctaccgccagaagcccgcgctt
catgcaggcgattgcgacgcggggtgctttgaatggctcatcgtcgacgattcccagaat
tcggtcttcgcgtggctgcgcaaggcgccgggcgcgaagccggttgcggtgatatccaac
atgaccccggcgctgcgtagcgggtatcgcgtgccgctgccgcacgagggcaagtggaac
gagatcctcaacagcgattccgcgcattacggcggatcgggcaaggggaacctggggcag
gtgaagtccgaaggcggtgcggcgacggtgaccttgccgccgctgggtactatcatgctc
gaatatgcgggctga

DBGET integrated database retrieval system