KEGG   Novosphingobium sp. PP1Y: PP1Y_Lpl1181Help
Entry
PP1Y_Lpl1181      CDS       T01515                                 

Definition
(GenBank) endoglucanase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
npp  Novosphingobium sp. PP1Y
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
Lpl:108870..109871
Genome map
AA seq 333 aa AA seqDB search
MAVDRRTFSTGLLVAMTAACTVGSQGKATVPASSWLLYRKRFVAPEGRVVDTGNGNISHS
EGQGYGMLLAAKARDADMFAKMARWTEANLGHKDMALHSWRYDPSSADPVSDPNNATDGD
VLIAWALAIAAQNWSVKAYAARSQAVRAAIRQHCVASRYGRSALMPGLAGFETGTALTIN
PSYFIWPAFDDFARMDGQGVWDDVISDSVALTTLSRFGPDALPTDWVDLTGHGEVAPASG
KPPRFGFDAVRVPLYAMMGNRPALAAPVAAYWRKCLAQAKPIPAWIDVVTGEEAPYAIST
GGAAVAGRLLGTTMPTQLASDYFAASLQLLATG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggccgttgatagacgcacattctcgaccggcctgctcgtggccatgaccgctgcctgc
acggtgggttcgcaaggcaaggcgacagtcccggccagcagctggctgctataccgcaag
cgctttgtggccccggaaggccgtgtggtcgataccggcaacggcaatatcagccacagc
gaggggcagggctacggcatgttgctggcggccaaggcgcgcgatgcggacatgttcgcg
aaaatggcgcggtggaccgaagcgaacctgggccacaaggacatggcgctgcattcctgg
cgctacgatccgtcgtccgccgatcctgtatccgatcccaacaatgcgaccgacggcgac
gtcctgatcgcctgggcgctggccatcgccgcgcagaactggtcggtgaaggcctatgcc
gcgcggtcgcaggcggtccgcgcggcgatccgtcagcattgcgtggccagccgctatggc
cggtcggcgctgatgccggggctggccggtttcgaaaccggcacggcgctgacgatcaac
ccgtcgtacttcatctggcccgcgtttgatgatttcgcccggatggacgggcagggcgtg
tgggacgatgtcatttccgacagcgtcgcgctgaccaccctgtcgcgcttcggtccggac
gccttgcccaccgactgggtggacctgaccggccacggcgaggttgcacctgcgagcgga
aagccgccgcgcttcggtttcgatgcggtgcgcgtgccgctttacgcgatgatgggcaat
cgtccggctctggcggcaccggtggcggcgtactggcgcaagtgtctggcgcaggccaag
ccgatccccgcgtggatcgatgtcgtgaccggggaagaggcaccttacgcgatctcgacc
ggcggcgcggcggtcgccgggcggctgctcggcaccactatgccgacgcaactggcctcc
gattatttcgccgcctcgttgcaattgctggcgacgggctga

DBGET integrated database retrieval system