KEGG   Novosphingobium sp. PP1Y: PP1Y_Mpl1219Help
Entry
PP1Y_Mpl1219      CDS       T01515                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PP1Y_Mpl1219
   00052 Galactose metabolism
    PP1Y_Mpl1219
Enzymes [BR:npp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PP1Y_Mpl1219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Mpl:complement(118507..119610)
Genome map
AA seq 367 aa AA seqDB search
MATGLCPSAHAAEAKREIAGALADGTEVSAITLKADNGISATILSYGATLQKLLAPDNHG
KIADVVLGYDTLSDYVEHPNYFGVTVGRYANRIAGGRFTLDGKTYQLPLNDDHNSLHGGG
HGFDKVAWQVVSVKSGPTASVVLSHVSPDGDAGYPGKVVSTVTYTLDEAGNLGIAFEART
DRPTVINMTNHAIFDMAGEGSSDGATGQMLTIPASRFTPVNADLIPTGELRPVEGSVFDF
RQSRRVADGLRDGTDRQIVFGRGYDHNFALDKGVTATPQLAARLEDPVSGRVLEVLTTEP
GVQFYSGNFLDGTLVGKQGHLYRMGDGIALEPQKFPDAPNHPDFVSARVDPGKPYRHVMI
YRLSTSR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaggcctttgcccatccgcgcatgcggccgaggcgaagcgcgaaatcgccgga
gccctggccgatggcaccgaagtgagcgcgatcaccctgaaggccgacaacggcatctcg
gccacgatcctgtcctacggcgccaccctgcagaagctgcttgcgccggacaaccatggc
aagatcgccgacgtagtcctcgggtatgatacgctgtccgactatgtcgagcatcccaat
tactttggcgtgacggttggccgctatgccaatcgcatcgccggtggccgcttcaccctc
gacggaaagacctaccagctgcccctcaacgacgaccacaacagcctccacggcggcggt
catggcttcgacaaggtcgcgtggcaggtcgtctccgtgaagtccggtccgaccgctagc
gtcgtgctgagccacgtcagcccggacggcgatgcaggctatccgggcaaggtcgtctcc
acggttacctacaccctcgacgaggccggaaacctcggcattgccttcgaggccaggacc
gacaggccaacggtcatcaacatgaccaatcacgcgatcttcgacatggccggcgagggg
tcgagcgatggcgcgacgggccagatgctgacgatcccggccagccggttcacgccggtc
aatgcggacctgatcccgaccggcgaactgcgcccggtcgagggaagcgtgttcgatttt
cgccagtcgcgccgcgtcgcggacggactgcgcgatggaaccgaccggcagatcgtcttc
ggcaggggctatgaccacaacttcgcgctcgataagggcgtgaccgccacgccgcagctt
gccgcaaggctcgaggaccccgtgtcgggccgcgtgctcgaagtgctcaccaccgagccg
ggcgtgcaattttactccggcaatttccttgacgggacgctggtgggcaagcagggccac
ctgtaccggatgggcgatggcatcgcgctcgaaccgcagaagttccccgatgcgcccaat
catcccgacttcgtctccgcccgtgtcgatcccggcaagccttaccggcatgtcatgatc
tatcgcctctccacttcgcgctga

DBGET integrated database retrieval system