KEGG   Novosphingobium sp. PP1Y: PP1Y_Mpl2207Help
Entry
PP1Y_Mpl2207      CDS       T01515                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:npp00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:npp00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:npp02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Mpl:215186..216925
Genome map
AA seq 579 aa AA seqDB search
MKRQISQACVSRRALLAGIAGTAALLGQPALLRAHEVSSNPTFRHGVASGDPDATGVVLW
TRVTAAGPVEVTWELSDTPDFAKLVGTGVFRTDASRDHTVKVLADGLAPGSIHYYRFRLG
DALSPVGRARTLPQGRLERLGIALASCSNYAFGFFNAYDAIARDSNVDFVLHTGDYIYEY
GGKDGWGADVAQAIGRVQAPLHEIVSLADYRMRHAQYKTDAGSQAMHANHTLLACWDDHE
SANNNWTGGAQNHQPDTEGDWNTRRAASIQAYFEWMPVREPKWLSAPGRKRMQFWRRYDF
GDLALLHTLETRHTARAKQIEYIDHAKDIVDQASAERFRKDVLGAPDRPILSPLLEQDLE
AALSDSVREGRPWRIIGCPMVIGRVEVPDVAALGIVPDPAPRLALAKTAEDFARLAADPA
VALAWKGKYNLPDYTDAWGGYPWARERLYGLSRRAGAGDLVFLSGDSHSFWVNRLADEDG
RPAGIEFGTAGISSPGDFVSSGFDDTTAQLLDRAYAEHIPEVTWTDNMHQGYVRVEFGRE
NGLATFVAVDTVLTPDYRTKVLRQVPFTRQGDVVDIVEA
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgccagatcagccaggcctgcgtatcccggcgcgccctgctcgcggggattgcc
ggcaccgcggccttgctgggccagccagcactccttcgcgcccatgaggtctcgagcaac
cccacctttcggcacggggtggcgagcggagatcccgatgccaccggcgtggtgctgtgg
acgcgcgtgaccgctgccggaccggtggaggtgacctgggaactcagcgacacgccggac
ttcgcaaagctggtcggaaccggcgttttccgcaccgatgcgagccgtgaccacacggtc
aaggtcctggccgacggtctcgcgccgggaagcatccactactatcgcttccggctcggc
gatgccctttcgcctgtcggccgcgcgcgaacccttccgcaaggtcgactggagcggctg
ggcatcgccctggcttcatgctcgaactacgccttcgggtttttcaatgcctatgacgcc
atcgcccgcgacagcaatgtcgatttcgtcctccacaccggcgactacatctacgaatat
ggcggcaaggacggttggggggcagatgtcgcgcaggcgatcggccgggtgcaggcccca
ttgcacgagatcgtctcgctcgcggattaccggatgcgccacgcacagtacaagaccgat
gcgggttcgcaggcgatgcatgccaatcatacgctcctggcctgctgggacgaccacgaa
agcgctaacaacaactggaccggcggcgcgcagaaccaccaacctgacaccgaaggcgac
tggaacacgcgccgcgccgcatcgatccaggcctatttcgaatggatgcccgtgcgtgaa
ccgaaatggctatcggctccgggacgcaagcgcatgcaattctggcgccgctacgacttc
ggcgaccttgccctgctgcacaccctggaaacccggcacaccgcgcgcgccaagcagatc
gaatatatcgatcatgccaaggacatagtcgatcaggcctcggcggagcgattccgcaag
gacgtgctcggcgcccccgaccgaccgatcctgtcgcccctgctggaacaggatctcgag
gcggcgctgtcggactcggttcgagagggtcggccatggcggatcatcggctgcccaatg
gtgatcggccgggtcgaagtgccggacgtggctgccctcggcatcgtgcccgatccagcg
cctcgactggcactcgcaaagaccgccgaagatttcgccaggctcgcagccgacccggcc
gtcgcgttggcatggaaaggcaagtacaaccttccggactatacggacgcctggggcggt
tacccgtgggcgcgcgaacgtctttacgggctttcgcgccgcgccggggccggcgatctg
gtcttcctgtccggagacagccacagtttctgggtcaatcggctggccgacgaagacggc
cgcccggcagggatcgaattcggaaccgcaggcatttcatcaccgggcgatttcgtatcg
agcggtttcgacgatacgaccgcgcaactgctagacagagcctatgccgaacacatcccc
gaagtgacctggaccgacaacatgcaccagggctacgtgcgcgtggaattcgggcgcgag
aacgggctagcgactttcgtcgccgtcgataccgtgctgacacccgattatcgcacgaaa
gtcctgcgccaggttcctttcacccgccaaggcgacgtcgtggacatcgtcgaagcctga

DBGET integrated database retrieval system