KEGG   Novosphingobium sp. PP1Y: PP1Y_Mpl3038Help
Entry
PP1Y_Mpl3038      CDS       T01515                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00071  Fatty acid degradation
npp00280  Valine, leucine and isoleucine degradation
npp00281  Geraniol degradation
npp00310  Lysine degradation
npp00360  Phenylalanine metabolism
npp00362  Benzoate degradation
npp00380  Tryptophan metabolism
npp00410  beta-Alanine metabolism
npp00627  Aminobenzoate degradation
npp00640  Propanoate metabolism
npp00650  Butanoate metabolism
npp00903  Limonene and pinene degradation
npp00930  Caprolactam degradation
npp01100  Metabolic pathways
npp01110  Biosynthesis of secondary metabolites
npp01120  Microbial metabolism in diverse environments
npp01130  Biosynthesis of antibiotics
npp01212  Fatty acid metabolism
Module
npp_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PP1Y_Mpl3038
   00650 Butanoate metabolism
    PP1Y_Mpl3038
  Lipid metabolism
   00071 Fatty acid degradation
    PP1Y_Mpl3038
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PP1Y_Mpl3038
   00310 Lysine degradation
    PP1Y_Mpl3038
   00360 Phenylalanine metabolism
    PP1Y_Mpl3038
   00380 Tryptophan metabolism
    PP1Y_Mpl3038
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PP1Y_Mpl3038
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PP1Y_Mpl3038
   00281 Geraniol degradation
    PP1Y_Mpl3038
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PP1Y_Mpl3038
   00627 Aminobenzoate degradation
    PP1Y_Mpl3038
   00930 Caprolactam degradation
    PP1Y_Mpl3038
Enzymes [BR:npp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PP1Y_Mpl3038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CCA90250
UniProt: F6ID75
Position
Mpl:complement(302434..303333)
Genome map
AA seq 299 aa AA seqDB search
MSDFVEPQKVDIVYETGEPVTYEVIDHVAWIMMNRPTFNNAQNGQMTYALDDAFMRATND
DEVRCIVLGGNGKHFSAGHDIGTPGRDLHFEFDKRLMVAPHTNKPAAELLYTREKEQYLG
MCRRWRDVPKPTIAMVQGACVAGGLMLAWVCDLIVASEDAFFQDPVNPLMGIPGVEYFAH
AYELPPRIAKEFLLLGERMSAQRAEQFGMVNKLVPRAELRDAVATWAAKLAGQPRLGNWL
TKQAVNHVEELGGKRTAMDAVYHMHHFAHAQNDLVTGNSIAGVSGKSAASANKKDAGES
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacttcgtcgaaccgcagaaagtcgacatcgtctatgagactggcgagccggtc
acctacgaggtgatcgaccatgtcgcgtggatcatgatgaaccggccgacgttcaacaat
gcccagaacgggcagatgacttatgcgctcgatgacgccttcatgcgcgcgacgaatgac
gacgaggtccgctgcatcgtgctgggcggcaacggcaagcacttctccgccgggcacgac
atcggcacgccggggcgcgacctgcatttcgagttcgacaagcggctgatggtcgccccg
cacaccaacaagccggcggcggaactgctctacacccgcgaaaaggagcagtacctgggc
atgtgtcggcgctggcgtgacgtgcccaagccgacgatagccatggtgcagggcgcctgc
gtggcgggtggcctcatgctcgcgtgggtctgcgacctgatcgtggccagcgaggatgcg
ttcttccaggacccggtgaaccccttgatgggtattcccggggtcgaatacttcgcccat
gcctatgaattgccgccgcgcattgccaaggagttcctgctgctgggcgagcgcatgagc
gcgcagcgcgccgagcagttcggcatggtcaacaagctggtgccgcgcgccgaattgcgt
gacgcggtggccacctgggctgcaaagcttgcgggtcagccgcgtctaggcaactggctg
accaagcaggccgtgaaccatgtcgaggaactgggcggcaagcgcacggcgatggatgcg
gtctatcacatgcaccacttcgctcatgcccagaacgatctcgtcaccggcaattcgatt
gcgggcgtcagcggcaagtcggccgcgagcgccaacaagaaagatgcgggcgaaagctga

DBGET integrated database retrieval system