KEGG   Novosphingobium sp. PP1Y: PP1Y_Mpl3259Help
Entry
PP1Y_Mpl3259      CDS       T01515                                 

Definition
hypothetical protein
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    PP1Y_Mpl3259
Enzymes [BR:npp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other, unknown, acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     PP1Y_Mpl3259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Mpl:324699..326450
Genome map
AA seq 583 aa AA seqDB search
MPPSPWGLRPEASVPEAGRDIRDWGLSIDAPLTLEDPETHDWDEAADMIVVGLGGAGVAA
ALEGLERGLSVIALDQYDGGGSSAANGGVFYAGGGTPIQREAGISDDAQRMEDYLRYEVG
DVVSPETLRDFCEQSAGTVEWLQRHGAPFEASYWPKKTSYPPLDKFLYHPDSSLAGPFRD
LTPPAARGHRTVRRNGGKPWGLGAGIWEPLRQAALNRGLVIHTQTEARQLALDSSGRVIG
VRVERFIDPAIRKRYSRHIAAANKWIAMLSPTFPGARLTFAIGYRHLAKAKALAAAGRTS
AWVRARRGVVLSAGGFICNPDMVRHFAPDYSAGLPNGTLGDNGSGIMLGVSAGGKTALME
RVSAWRFLSPPRAWGQALLVNGRGERYCNETWYGARIGDEMVERNGGRGYIIMDRKLFRQ
SLRDAFGEGVLGFQRDITLVNAFFAAEKGPTPAALAAKLGCDPALLAANIAAYNRAARGE
KPDRFHKSPDEMAVLDRGPYYAIDASVDARMFPIACMTVGGLSVDEKSGAVRRREGEDIV
PGLYAAGRNAVGICSNLYVSGLSYADCIYSGRRAARAISESGQ
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgccccccagcccgtggggtctgcggccggaagcgtccgtccctgaggccgggcgcgat
atccgcgactgggggctgtcgatcgacgcgccgctgacgctcgaagatcccgaaacgcac
gactgggatgaagcggcggacatgatcgtcgtcggccttggcggcgcaggcgtggcagcg
gcgctggaagggttggagcgcgggctctcggtcattgcactcgaccaatatgacggcggc
ggatcgtcggcggcgaacggcggcgtcttctatgcgggaggcggcacgccgatccagcgc
gaggcaggcatttccgacgatgcgcagcgcatggaagactacctgcgctacgaagtgggc
gatgtcgtctcgcccgagaccctgcgcgacttctgcgagcagagcgccggcaccgtcgaa
tggttgcagcgccacggcgcaccgttcgaggcaagctattggccgaaaaagacctcgtac
ccgccgctcgacaagttcctttaccaccccgacagcagccttgccggaccgttccgcgac
ctgaccccgcccgccgcgcgcggtcaccggaccgtgcggcgcaatggcggcaaaccctgg
ggactcggcgcgggcatctgggaaccgctcaggcaggcagcgctgaaccgcggtctcgta
atccacacccagaccgaagcccgccagcttgccctcgacagcagcggacgggtgatcggc
gtgcgggtcgagcgtttcatcgaccccgccattcgcaaacgctattcgcggcacatcgcc
gcggcgaacaagtggatagcgatgctttcgcccacgtttcccggcgcacggctgactttc
gccatcggctaccgccacctcgccaaggccaaggcgcttgcagccgcaggccgcaccagt
gcgtgggtccgcgcccgccgcggcgtcgtactgagcgcgggcggcttcatctgcaacccg
gacatggtccgccatttcgcgcccgactattcggccggtctgcccaacggcaccctggga
gacaatggcagcggtatcatgctgggcgtctcggccggcgggaagaccgcgctgatggag
cgcgtctccgcgtggcgcttcctgtccccgccgcgcgcatggggacaggccctgctcgtc
aacgggaggggcgagcgatattgcaacgagacatggtacggcgcgcgcatcggcgatgag
atggtcgaacgcaacggcgggcgcggctacatcatcatggaccgcaagctgttccgccag
tcgctgcgcgatgccttcggcgaaggcgtgctgggcttccagcgcgacatcacgctcgtc
aatgccttcttcgccgcggaaaagggccccacgccagcggcgcttgccgcgaagttgggc
tgcgatcctgccttactggcggccaacatagcggcctacaaccgcgccgcacgcggcgag
aagcccgaccgtttccacaagtcacctgacgaaatggccgtactcgatagggggccctac
tatgccatcgacgcctccgtcgacgcgcgcatgttccccattgcctgcatgaccgtgggc
ggcctctccgtcgacgagaagagcggcgcggtccggaggcgtgagggcgaggacatcgtg
cccggcctctacgcagcggggcgcaacgcagtgggcatctgctccaacctctacgtcagc
ggcctctcctacgccgactgcatctattcgggccgccgcgccgcccgggcaatttcagag
tcgggacaatga

DBGET integrated database retrieval system