KEGG   Novosphingobium sp. PP1Y: PP1Y_Mpl6073Help
Entry
PP1Y_Mpl6073      CDS       T01515                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00240  Pyrimidine metabolism
npp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PP1Y_Mpl6073
Enzymes [BR:npp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     PP1Y_Mpl6073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYNP_C Glycos_transf_3 Glycos_trans_3N TPR_9
Motif
Other DBs
NCBI-ProteinID: CCA90511
UniProt: F6IDY6
Position
Mpl:complement(611058..612545)
Genome map
AA seq 495 aa AA seqDB search
MLKIKRLAIDTHPENTAFLLRHGNGYSAEQFQALRKIRISSDTSEILATLAVVDESAWIT
AGEIGLGEQAFRRLGLPEGAEVVIEQARPPVSLEFVRRKIDGDTLEDSEIVAIVRDIAAH
RYSPMEIGAYLVACAGFMSTQETLSITRAMADVGEKLDWKSPLVVDKHCIGGIPGNRTSM
IVVPIVAAHGLIMPKTSSRAITSPSGTADTMEVLANVNLCARDMQAIVSKEHAVLAWGGQ
VNLSPADDILISVERPLRIDTFEQMVASILSKKLAAGSTHLVLDIPVGPTAKVRSQSEAV
RLRKLFEYVAGKLGIEIDVVITDGSQPIGRGIGPVLEARDVMAVLRNDSDAPEDLRDRAL
LLAGHILDFDPELKGGRGFARAMEMLASGAALQAMERLIAAQGPQTEKFAPGQFTHEVCA
PLDGRISMIDCHVIARIARLAGAPMDKGAGIDLLHKVGEQVRKGEALYRIHAQSETGLGF
ARDLAGEDSGYEVLR
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgctaaagataaaacgcctggccatcgacactcaccccgagaacaccgctttcctgctg
cgtcacggcaatggctactcggctgagcagttccaggccctgcgcaagatccggatcagc
agcgatacctcggaaatcctcgccacgctcgcagtcgtcgacgaaagcgcctggatcacg
gcgggcgagatcggactgggagaacaggccttccgccggctcggcctgcccgaaggcgcc
gaagtcgtgatcgaacaggcccgcccgccggtcagcctcgaattcgtgcgccgcaagatc
gacggggatacgctggaagacagcgaaatcgttgccatcgtgcgcgacatcgccgcccat
cgctattcgcccatggaaatcggcgcctacctcgtggcctgcgccggcttcatgagcacg
caggaaacgctgtcgatcacgcgcgccatggccgacgtgggggagaagctcgactggaaa
tcgccgctggtggtcgacaagcattgtatcggcggcattcccggcaaccgcacttcgatg
atcgtcgtgccgatcgtggccgcgcacggcctgatcatgcccaagacgtcttcgcgcgcg
atcacctcgccctcgggtaccgccgacacgatggaagtgctcgccaatgtcaatttgtgc
gcgagggacatgcaggcgatcgtgtcgaaggaacatgccgtcctggcctggggcggccag
gtcaatctttcacccgccgacgacatcctgatctccgtcgagcgcccgctgcgcatcgat
accttcgaacagatggtcgcctcgatcctctccaagaaactggcggcaggatcgacccat
ctcgtgctcgacatcccggtagggccgaccgccaaggtccgctcgcaaagcgaagccgtg
cgcctgcgcaagcttttcgaatatgtcgcaggcaagttgggcatcgagatcgacgtcgtc
atcaccgacggttcccagccgatcggacgcgggatcggtccggtgctggaggcacgcgac
gtcatggcggtgctgcgcaacgattccgatgcgcccgaagacctgcgcgaccgggcgctg
ctgctggccgggcacattcttgatttcgatcccgaactcaagggcggaagaggctttgcc
agggcgatggaaatgctggcgtccggcgccgctttgcaggccatggaacggctgatcgct
gcgcagggcccgcagaccgagaaattcgcgcctgggcaattcacgcatgaagtctgcgcg
ccgctcgatggtcgcatcagcatgatcgattgccacgtgatcgctcgcatcgcccgcctt
gccggggcgccgatggacaagggcgcaggcatcgacctgctgcacaaggtcggcgaacag
gtccgcaagggagaagcgctctatcgtatccatgcccagtccgagacgggcctgggcttt
gcccgcgatctggctggcgaggacagcggctacgaggtcctgcgttga

DBGET integrated database retrieval system