KEGG   Novosphingobium sp. PP1Y: PP1Y_Mpl9567Help
Entry
PP1Y_Mpl9567      CDS       T01515                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npp00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PP1Y_Mpl9567
Enzymes [BR:npp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PP1Y_Mpl9567
Exosome [BR:npp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PP1Y_Mpl9567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Mpl:950585..952063
Genome map
AA seq 492 aa AA seqDB search
MQERPILVLDEGTTSTRAILYSAEGSILGVSQSELTQHYPAPGYVEHDADEIWEKTLACA
REMVARAGGADRISAIGITNQRETVVAWDRQSGKPITPAIVWQDRRTADRCQQLREAGHE
PMIGARTGLMLDPYFSATKMSWVLENVPAARELGDRLAFGTVESWLVWKLTAGLHITDAS
NASRTMLMPLEGAGWDDELLALHGVPRASLPEIVDNAGQFERTSPELFGGSIAICGLAGD
QQAATIGQNCLSPGDVKATLGTGAFVLANTGTSPRLSSHRLVSTVLAQIGGERSYALEGS
VFVAGSLVKWLRDELCMVGTACETESLARSIADSGGVCILPALSGLGAPHWRAEARGVIA
GLTHGTGRAHIVRAALEAMAHQMHDLKVAFDGDGAAWLNLRLDGGMSANDWIAQDLSDIL
DLQVERPLDVETTALGAAMLASVGCGIFGSLEEAARMRPEVMVFRPAMDSAMRRARLGLW
HDVLASELGKGT
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagagcgccccattctggttctcgatgaaggaacgacctcgaccagagccatattg
tactctgccgagggcagcattctgggcgtgtcccagtcggaactgacgcagcattatcct
gcgcccggctacgttgagcacgatgcagacgaaatctgggaaaagacgctcgcctgcgcg
cgggaaatggtcgcgagggcaggcggcgcggatcgcatctctgccatcggcattaccaac
cagcgcgaaaccgttgttgcctgggaccgccagagcggcaagccgatcacccccgccatc
gtctggcaggaccgccgcacagcggaccgctgccagcaattgcgggaagcgggtcatgaa
ccgatgatcggtgcgcggaccggcctgatgctcgatccctatttttcggcaacgaagatg
agctgggttctcgaaaacgtgccggcggcgcgcgagctcggggacaggctggctttcgga
actgtcgagagctggctggtctggaagctcaccgcagggttgcatatcaccgacgccagc
aatgccagccggacgatgctgatgccgctggaaggcgcgggctgggatgacgagctgctc
gcgcttcacggcgtcccgcgcgccagcctgcccgagatcgtcgacaatgccggacaattc
gagcggacgagcccggaactgttcggtggatcgattgccatatgcggtctggccggagat
cagcaggcagcaacgatcggtcagaattgcctctcacccggagacgtcaaggccacgctg
ggaacaggcgctttcgtcctggcaaacacgggaacctcgccgaggttgtcgagtcacagg
ctggtgagcaccgtgctggcgcagatcggcggagagcgcagctacgcgctggaaggctcg
gtcttcgtcgccggcagcctggtcaaatggctgcgcgacgaactgtgcatggtcggaact
gcctgcgaaaccgaaagtctcgcccgctcgattgcggacagcggcggcgtttgcattttg
ccggccctgtcgggcctcggggccccgcactggcgtgccgaagcgcgcggagtcattgcg
ggactgacccatggcaccgggcgggcacacatcgttcgcgctgcgctggaagccatggcc
catcagatgcatgatctcaaagttgccttcgacggtgacggcgcggcatggctcaacctg
cgtctcgacggcggcatgagtgcgaacgactggatcgcacaggacctttccgacatcctc
gatctgcaggtcgaaaggccgctcgatgtggagacaactgccctgggggcggcgatgttg
gcaagcgtaggttgcggtatcttcggatcgctggaagaggccgccaggatgcgtcccgag
gtcatggtcttcaggccggccatggactctgcgatgcgtcgcgcccgccttggcctgtgg
cacgacgtgctggcctccgaactggggaagggcacctga

DBGET integrated database retrieval system