KEGG   Nanorana parkeri: 108788571Help
Entry
108788571         CDS       T04897                                 

Gene name
ABHD12B
Definition
(RefSeq) protein ABHD12B
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
npr  Nanorana parkeri
Brite
Enzymes [BR:npr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     108788571 (ABHD12B)
Peptidases [BR:npr01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   108788571 (ABHD12B)
Exosome [BR:npr04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   108788571 (ABHD12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 485 aa AA seqDB search
MALGNQASKHLEESNVKTLAIHLLRTEEGVVGQWDEGHSCTPRSDEGDRNAVGDRACSVI
DMNGTAPARPDLHDPVRSGLRPHRAALDMVRLGRQGLLLHPCDCFHKAYSLRLLVMVAHS
PPPLATSSSSPTLNMMTPEGPPTAWSVEESAGACQSRGVSQSKWLFFLKTFGAALVVIYI
CVPFIIRLFPAILGKVVYLNMVKFPFFVDLKNPGELLNHTANFYLTSEEGVNIGVWHTVP
ASRGEEARGKDRRWFEDSLADDNPIIIYLHGNGGTRAMDHRVQLMKVLSKAGFHVLALDY
RGFADSTGEPSEAGVTQDSVFLYEWVKARSHGNPVCLWGHSLGTGIATNAARKLQEKGNP
ADAVILEAPYTNIRDAGAYHPFGKIYHIYPGFEYFFLDTFALSNQVFPNDENVKKMTSPL
MILHAEDDNVVPVSMGKELHEIAINSRHPRDVILILYPAMLGYKHKFIYKDPKLPEKLWA
FLNNI
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggcacttgggaaccaggcatccaaacacctagaagagtccaacgtgaagactcttgcc
atacatctcttgagaactgaggaaggggtggtgggacagtgggatgaagggcattcttgt
accccgcgttccgatgagggtgatcgcaatgcagtcggggaccgtgcctgcagtgtcatt
gacatgaacggcactgcccctgcccggcctgatctacacgatccagtgcgttccgggctc
agaccacaccgggccgcactggatatggtgcgactgggccgtcaaggcctcctcctacat
ccatgtgattgcttccacaaagcttactctctaaggctcctagtcatggttgcacactcg
cctcctccactcgccacctcctccagtagccccacattgaacatgatgacacctgaagga
cctcccacagcctggagtgtcgaggagagtgctggagcctgccagagcaggggggtaagc
caatcaaaatggttgttcttcctgaaaacatttggcgcggcccttgtggtcatttacata
tgtgtccctttcataatcaggctcttcccggcaatattaggcaaagttgtgtatttaaac
atggtaaaatttcctttcttcgtcgacttgaagaatcctggagaactcttgaaccacacc
gcaaatttttacctgacgtctgaagaaggggtgaacatcggagtctggcataccgtgcct
gccagcaggggggaagaggcgagagggaaggaccgccgctggtttgaagactctctcgca
gatgacaacccaattatcatttatctccatggcaatgggggaaccagggccatggatcac
agagtacaactgatgaaggttctcagtaaagccggcttccatgtcttggcgctcgactac
cgaggttttgctgactccaccggtgagccgagcgaggctggagtgacccaagattccgtc
tttttatatgaatgggtgaaagcccgcagccatggaaatccggtctgcctctgggggcat
tctctgggtaccggtattgccactaatgcagccaggaaattgcaagaaaaagggaatcca
gctgacgcggtgatcctggaggccccgtataccaacatccgggatgctggagcttatcac
cctttcggaaagatctaccacatttaccccggatttgaatactttttcttggacaccttt
gcactgagcaatcaagtgtttcccaatgatgaaaatgttaaaaagatgaccagcccactc
atgatcctgcacgcagaagacgacaatgtagttcccgtgtcaatgggaaaggagctccat
gaaatagccataaactcacgtcatcccagggatgtgatcctgatattgtaccccgccatg
cttggctacaaacacaaatttatttataaagaccccaaactgccagagaagctttgggct
tttctgaacaacatctga

DBGET integrated database retrieval system