KEGG   Nostoc punctiforme: Npun_AR019Help
Entry
Npun_AR019        CDS       T00713                                 

Definition
RecD/TraA family helicase (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
npu  Nostoc punctiforme
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:npu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI_p1: 
CyanoBase: 
CYORF: 
UniProt: 
Position
pNPUN01:complement(19236..21482)
Genome map
AA seq 748 aa AA seqDB search
MFTPPNLSAQQISALPQHETIIGVVERLTFYSAESGYTVARLTRPRSNELTTIVGSFANI
QPGQTLQLTGFWRDHPQFGPQFQVVNYKETKPATLTGIEKYLGSGLIKSVGPVTAKRIVA
HFGLETLDIIENQIERLIEVQGIAKKRITLIKNAWETQKAIKEVMVFLQGHGVSTTYAVK
IYKQYKDEAIATVTKNPYQLAADIYGIGFLTADKIARNIGIAPDSEFRYRAGIIHCLSVA
AEDGHCYLPQSELIESVIKLLTTESHQPTEEAVAIVIKDMALADELIRERDEEKTLLCYK
PTYFHTEQNLAQLIRQRLEKPVDTDIPRVRAWIERFTTSRQIQLSEQQRLAVETAAYSKI
TILTGGPGVGKTFTTHTIVSLWKAMGKSIALAAPTGRAAQRLGEMTGLEAKTIHRLLEFD
PRSMGFKRDNENPLPHTAIIADEASMLDLFLAYSLVKAVLAGALLLLVGDIDQLPSVGPG
QILADLINSGRVPVVRLTQIFRQAQTSAIITAAHQINRGQYPTIEPISDNPVSDCIWHGG
GHQPEHGVQAICELITDLIPRLGFNPATDVQVLCPMTRGVVGTRNLNTVLQQLINPPSPN
KVEINRGGNLLREGDRIIQLTNDYNREVFNGDLGIILTIDTIEQEVTVQYGERTVIYDYA
DLNEIALAWCVTIHKSQGSEYLVVIVPIYMQHYMMLTRNLFYTGLTRAKKLAIVVGAKKA
ISLAVRSTDDQQRYTRLQQRLLHAGLDW
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgttcactcctcctaatctttccgctcaacaaataagtgccttacctcaacacgaaaca
atcatcggagtcgtagaacgtttaactttttactctgctgagtcaggctacactgtggca
aggctgactcgtccgcgtagcaacgaactcacaacaatcgttggcagctttgctaacatt
cagccagggcagaccttacaactaactggtttctggcgtgaccatccacaatttggcccc
caattccaagtagtcaactacaaagaaaccaaaccagctactctcactggaattgaaaaa
tatttgggtagtgggctgattaaaagtgttggcccagtaacagccaagcgtatcgtcgct
cacttcggtttagaaacgctcgacatcatcgaaaatcagattgaacgactgattgaagtc
cagggtattgccaaaaagcggatcactctcattaaaaacgcctgggaaactcaaaaagcg
atcaaagaagttatggtgtttctccaggggcatggcgtttctaccacttatgctgtaaag
atttacaagcaatataaagatgaagcgatcgccactgttaccaaaaatccctaccagtta
gcagccgacatctacggtattggctttctgactgctgacaagattgcaagaaatatcgga
attgcccctgactcagaatttcgttaccgtgcggggattatccattgccttagtgttgct
gccgaagatggccactgttacttgccacaaagcgaattgattgagtcggtaatcaaacta
ctgactaccgaatctcaccagcccacagaagaagcggtagcgatagttattaaagatatg
gctctcgcagacgagctgattagagagcgggatgaagaaaaaacactactttgctacaag
ccgacttattttcatacggaacagaatttagctcaactgatccgccaacgtttagaaaag
cctgttgatactgacattccccgcgtccgcgcctggattgagcgcttcaccactagccgt
caaattcagctttcagaacagcaacgcttggcagtagaaacagcagcttattccaaaatc
acaatcctcactggtggccctggcgttggaaaaactttcactacccatactattgtctca
ctttggaaagcaatgggtaaatctattgccctggctgcacctacgggacgggctgctcaa
cgcttgggtgaaatgacggggctggaagctaaaactattcatcgcttgttagaatttgat
ccccgctcaatgggtttcaagcgcgataacgaaaatcctttaccccacacggcaattatt
gctgacgaagcatcgatgcttgacttgtttctagcttactctttagttaaagcagtattg
gctggcgctctactgttattggtaggtgacattgaccagttgccgtcagtagggccaggt
caaatactcgctgacctgattaattcggggcgagttcctgtggtgcggttaactcagata
tttcgccaagcccaaaccagtgcaattatcactgctgctcaccaaattaatagagggcag
tatcccacaatcgagccaatttctgataatcccgtgtctgattgtatttggcacggcggc
ggacatcagccggaacatggagtacaagcaatctgtgaattaatcacagatttaattccc
cgcttaggttttaatccggctactgatgttcaggtactttgcccaatgacgcggggtgta
gttgggactcgcaacctaaataccgtattgcagcagttgattaatccgcccagccccaac
aaagtggagattaacagaggtggaaatttgttgcgagagggcgatcgcatcatccaacta
accaacgactacaaccgcgaagtcttcaatggcgatttaggaataatcctcaccattgat
actattgagcaagaagttacagtgcaatatggtgagcggactgtcatttatgattacgct
gacctgaatgaaattgccctagcatggtgcgtgactattcataaaagccaggggtcagaa
tatctagtggtgattgtgccaatctacatgcagcactatatgatgttgacccggaacctg
ttttacaccgggctgacccgtgccaagaaattagcgatcgtggttggcgcaaaaaaagcg
atatctttagcggtgcgttctaccgatgaccaacagcgctacacacggttacagcagagg
ttacttcatgctggactagattggtaa

DBGET integrated database retrieval system