KEGG   Nostoc punctiforme: Npun_BF231Help
Entry
Npun_BF231        CDS       T00713                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
npu  Nostoc punctiforme
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:npu02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:npu02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI_p2: 
CyanoBase: 
CYORF: 
UniProt: 
Position
pNPUN02:253503..254513
Genome map
AA seq 336 aa AA seqDB search
MLEHNIIVIGTSAGGVEALTYLVKHLPPDLKAAVIIVLHVSNHGTSVLPKILSRAGNLPA
SHAQDGEAIIHGRIYIAPPDYHLLVESVYLRLTRGPKENRHRPAIDTLFRSAARSYGQRA
IAVLLTGMLDDGTAGLVAIKMRGGVAIVQNPDDALHPDMPRNAIENVLDIDYIQPLSDIP
STLVALVNTPMKVEPENPIPDKMEFESSIVQLDLEAVKNEADRPGKPSIFGCPDCGGILW
ELEEGNLLRFRCRTGHAFSAETLLATQSDKVEDALWIAFRALEEKASLSHRMALRMEEHN
QALAAKRFKEQAESAWQHSAIIREILLKADTSTGVD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaacataatattatcgtcattggaacatcagcaggtggagttgaagcactgacc
tatttagtcaagcatttgccgcccgatctcaaagctgctgtaattatcgttcttcatgta
tctaatcatggcacaagtgttctaccaaaaatattaagtcgcgctggcaacttgccagcg
tctcacgctcaggacggcgaagctattattcatggtcggatttatatcgctccacctgac
taccacttactggtagaatcggtatatttgcgtttgacgcgggggccaaaagagaatcgt
catcgtcctgccattgatacattgtttcgcagtgcagcgcgaagttatgggcagcgagcg
atcgctgtgctactaacaggtatgcttgacgacggcacggcgggattagtggctataaaa
atgcgtggaggtgtggcgattgtccaaaaccctgatgatgctttgcatcctgatatgcca
cgtaatgcgatcgaaaatgttttggatattgactatattcaaccactttcagatattcct
tctactttagtagctttagttaacacgccaatgaaagtagaaccagaaaatccgatacct
gacaagatggagtttgaatcttcaatagtgcaattggatttggaagcagtaaaaaacgaa
gccgaccgacccggtaaaccatcaatctttgggtgccctgactgtggtggtatcctttgg
gaacttgaggaggggaatttgttgcgcttccgatgtcgcacgggtcatgctttttcagca
gaaactttactggctacccagtccgataaggtggaggatgcattatggattgctttcagg
gcattggaagagaaagcttctttatcacatcgtatggctttgagaatggaggaacacaac
caagccttggcagcaaaaagattcaaggaacaggcagagtctgcttggcagcactccgcc
atcattcgagaaatacttttgaaggctgatacaagcacaggtgttgattga

DBGET integrated database retrieval system