KEGG   Nostoc punctiforme: Npun_F0013Help
Entry
Npun_F0013        CDS       T00713                                 

Definition
alpha amylase (EC:2.4.1.19)
Orthology
K00701  
cyclomaltodextrin glucanotransferase [EC:2.4.1.19]
Organism
npu  Nostoc punctiforme
Brite
Enzymes [BR:npu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.19  cyclomaltodextrin glucanotransferase
     Npun_F0013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
22525..24453
Genome map
AA seq 642 aa AA seqDB search
MVKTPPSQFSPDQYKVDSAQEKVNAIIETPPSETEIDLEFLYTRDIEFRQETIYFLVVDR
FYDGDPDNSEGENSELYDPNRQEWGKYWGGDLQGVIDKLDYLKNMGVTALWLTPLFEQVE
ELFISNAAMHGYWTKDFKRINPRYIADGENPSLNATQEEKNTTFDRLVTELHKRNMKLVL
DIVCNHSSPDTSGSKGELYDDGVKIADFNDDVNHWYHHYGEVQNWEDDWQVQNCELAGLA
TFNENNTEYRQYIKSAIKQWLDRGVDALRVDTVKHMPIWFWQEFTGEMTNHKPDVFIFGE
WIYSNPSDDRSVEFANHSGMTLLDFGLCVAIRAALGQGSEMGFQTIQYIFDQDYRYSGAT
ELVTFIDNHDMCRFQSLNPDPAMLKVAIALIMTSRGIPCIYYGTEQYLHNDTDGGNDPYN
RPMMENWDTDSEVYRCIRLLSGLRRLNPAVSMGSHWQKYLTADIYCYVRRYRDSLCFVAL
NRGGEVILPEVETELPDGEHTCVVTRNKYEVKDGKIYNLVLEERGVLVFSHVGERIKAQT
IVRVQLNGVDTQPGEIIVVTGDCPELGNWDISKAYPLEYINSNTWSAEIPFDESTGKLIA
YKYAMWREGRSPLRENLVNRRWVIAKEGTVKWRDTWASGRES
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaacccctccatctcagttttccccagatcaatacaaagttgattctgcacaa
gaaaaagtaaacgctattatagaaacgccaccatcagaaactgagattgacctagagttt
ctttacaccagagatattgaatttcgtcaggaaactatttactttctggtggtagatcgc
ttttatgatggcgatccagataacagcgaaggtgaaaattcagaactctacgatcccaat
agacaagaatggggtaagtactggggtggtgacttgcaaggtgtcatcgataaattagat
tatctcaaaaatatgggagttaccgccctttggctaactccactattcgagcaagtagaa
gagttatttattagcaatgcggcgatgcatggctattggacaaaagactttaaacggatt
aatcctcgctacattgctgatggagaaaacccttctttaaatgctacccaagaagaaaaa
aatacgacctttgatcggttagttacagaactgcacaagcggaatatgaagttggtgctg
gatattgtctgcaaccatagcagtcctgatactagtggtagtaaaggtgaattgtatgat
gatggcgttaaaattgctgatttcaatgatgatgtcaatcattggtatcaccactatggc
gaagtgcaaaactgggaagacgattggcaagtacagaattgtgaactagcaggtcttgca
accttcaatgaaaataatacagaatatcggcagtatattaagtcagcaattaaacaatgg
ctagaccggggtgtggatgcactgcgggttgatactgtcaagcacatgccgatttggttt
tggcaagaattcactggcgagatgaccaatcacaaaccagatgtatttatttttggtgaa
tggatttatagtaatccgagtgacgatcgctcggtggaatttgccaatcattcaggcatg
acacttctagactttgggctatgtgtggcaattcgagccgcattgggccaaggttcagaa
atgggattccaaacaattcaatacatttttgaccaggattatcgctatagcggggcaaca
gagttagttaccttcatcgataaccatgatatgtgccgcttccaatcgctgaatccagat
ccagcgatgttgaaggttgcgatcgccctaattatgacatctcgcggtattccctgtata
tattacggcacagaacagtatttacataacgatactgatggcggtaatgacccatataat
cgcccgatgatggaaaattgggatactgatagtgaggtttatcgttgtattagattgctg
tctggtttacggcggctaaatcctgctgtgtcaatgggtagccattggcagaaatacttg
accgccgatatctactgttatgtccgccgctatcgtgattctctgtgttttgtagcttta
aaccggggaggggaagttattctcccagaagtagaaacagaattgcccgatggcgagcat
acttgcgtagtgactcgcaataagtatgaagtaaaagacggcaagatttataaccttgta
ttagaagaacggggagtgcttgttttcagccacgttggggaacggatcaaagcacagaca
attgtgcgcgttcaactcaatggtgtggatacccaacccggtgaaatcattgtggtgaca
ggagattgcccagagttgggtaactgggatatcagcaaagcatatcctttggagtatatc
aactcaaatacttggtctgctgagattccctttgatgaaagcactggtaagctaattgct
tataaatatgccatgtggcgcgaagggcgatcgcctctgcgggaaaatttggtcaatcgt
cgctgggtgattgccaaagaaggtaccgttaaatggcgcgatacttgggcatcgggaaga
gaatcgtag

DBGET integrated database retrieval system