KEGG   Nostoc punctiforme: Npun_F0278Help
Entry
Npun_F0278        CDS       T00713                                 

Definition
(GenBank) photosystem II protein PsbM
  KO
K02714  
photosystem II PsbM protein
Organism
npu  Nostoc punctiforme
Pathway
Photosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    Npun_F0278
Photosynthesis proteins [BR:npu00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    Npun_F0278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
347830..347946
Genome map
AA seq 38 aa AA seqDB search
MQVNDLGFVASILFVLVPTVFLLILYIQTASRQGGKDS
NT seq 117 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttaatgacctggggttcgtagcgagcattttgttcgtattagttcccactgta
tttttactcattctgtacatccaaactgctagccgccaaggtggaaaagatagttaa

DBGET integrated database retrieval system