KEGG   Nostoc punctiforme: Npun_F0328Help
Entry
Npun_F0328        CDS       T00713                                 

Definition
(RefSeq) gamma-glutamyl kinase (EC:2.7.2.11)
  KO
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
npu  Nostoc punctiforme
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Npun_F0328
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Npun_F0328
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Npun_F0328
Enzymes [BR:npu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Npun_F0328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
412912..414015
Genome map
AA seq 367 aa AA seqDB search
MTKTIVVKIGTSSLTQAETGQLALSTIATLAETLCHLRSQGHRVILVSSGAVGVGCARLG
LTERPRAIALKQAVAAVGQGRLIRIYDDLFTTLQQAIAQVLLTRSDLVQRSRYLNAYNTF
QELLGLGVIPIVNENDTVAIDELKFGDNDTLSALVASLIEADWLFLLTDVDRLYSADPRS
VPDARPIALVSSIKELAELQIGSQGSQWGTGGMVTKISAARIAIAAGVRTVITQGRFPQN
IEKIIQGELIGTHFEPQPEPTSARKRWIAYGLLPAGKLYLDEGAIAAISLAGKSLLAAGI
KLVEGEFDTQDAVQLCDSNGNEIARGLVNYNSNDLQKIRGCHSREISTILGYAGAETVIH
RDNLVLI
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacaattgttgtcaaaatcggtacttctagcctaactcaagcagaaacggga
caattagcactttccactatcgctaccttggcggaaacactttgccatttgagaagccag
ggacaccgggtaattttggtttcttctggcgctgtgggtgtgggttgtgcaaggttgggg
ttaactgaacgtcctagagcgatcgcactcaaacaagctgtagcagcagtcggacaaggt
aggttaatccgtatatatgatgatttgtttactacgctgcaacaggcgatcgctcaagta
ttactgacacgaagcgatctagtacagcgcagccgctatctcaatgcctacaacaccttt
caggaattactgggactgggagtgatccccatagtcaatgaaaatgataccgtagcaata
gacgaactaaaatttggtgataatgataccctttcggcattagttgctagcttaatagaa
gcagattggctatttttgctcaccgatgtcgataggttgtactcagccgatccacgttct
gtcccagatgctcgaccgatcgctctagttagtagcattaaagaattagctgaattacaa
ataggttcccaaggttctcagtggggtactggtgggatggtgacaaaaatttcggctgcg
aggattgcgatcgcggcgggagttcgtaccgtaattacccaagggcgatttccccagaat
atagaaaaaattatccaaggtgaactgattgggacgcattttgaaccgcaacctgaacca
acttcggcgcgtaaacgttggatagcttacggacttttacctgcgggtaaattgtattta
gatgaaggtgcgatcgcggcaatttctctagcaggaaaatcgttattagctgctggaatt
aagttagtagaaggagagtttgacacacaggatgcagtgcaattgtgtgacagtaatggt
aacgaaattgccagaggacttgtgaattacaacagcaatgatctgcaaaagattcgtggt
tgtcattcacgagaaatttccacaattttaggttatgccggtgcagaaacagttattcac
cgagataatttggttttgatttag

DBGET integrated database retrieval system