KEGG   Nostoc punctiforme: Npun_F0328Help
Entry
Npun_F0328        CDS       T00713                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
npu  Nostoc punctiforme
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:npu01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:npu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
412912..414015
Genome map
AA seq 367 aa AA seqDB search
MTKTIVVKIGTSSLTQAETGQLALSTIATLAETLCHLRSQGHRVILVSSGAVGVGCARLG
LTERPRAIALKQAVAAVGQGRLIRIYDDLFTTLQQAIAQVLLTRSDLVQRSRYLNAYNTF
QELLGLGVIPIVNENDTVAIDELKFGDNDTLSALVASLIEADWLFLLTDVDRLYSADPRS
VPDARPIALVSSIKELAELQIGSQGSQWGTGGMVTKISAARIAIAAGVRTVITQGRFPQN
IEKIIQGELIGTHFEPQPEPTSARKRWIAYGLLPAGKLYLDEGAIAAISLAGKSLLAAGI
KLVEGEFDTQDAVQLCDSNGNEIARGLVNYNSNDLQKIRGCHSREISTILGYAGAETVIH
RDNLVLI
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacaattgttgtcaaaatcggtacttctagcctaactcaagcagaaacggga
caattagcactttccactatcgctaccttggcggaaacactttgccatttgagaagccag
ggacaccgggtaattttggtttcttctggcgctgtgggtgtgggttgtgcaaggttgggg
ttaactgaacgtcctagagcgatcgcactcaaacaagctgtagcagcagtcggacaaggt
aggttaatccgtatatatgatgatttgtttactacgctgcaacaggcgatcgctcaagta
ttactgacacgaagcgatctagtacagcgcagccgctatctcaatgcctacaacaccttt
caggaattactgggactgggagtgatccccatagtcaatgaaaatgataccgtagcaata
gacgaactaaaatttggtgataatgataccctttcggcattagttgctagcttaatagaa
gcagattggctatttttgctcaccgatgtcgataggttgtactcagccgatccacgttct
gtcccagatgctcgaccgatcgctctagttagtagcattaaagaattagctgaattacaa
ataggttcccaaggttctcagtggggtactggtgggatggtgacaaaaatttcggctgcg
aggattgcgatcgcggcgggagttcgtaccgtaattacccaagggcgatttccccagaat
atagaaaaaattatccaaggtgaactgattgggacgcattttgaaccgcaacctgaacca
acttcggcgcgtaaacgttggatagcttacggacttttacctgcgggtaaattgtattta
gatgaaggtgcgatcgcggcaatttctctagcaggaaaatcgttattagctgctggaatt
aagttagtagaaggagagtttgacacacaggatgcagtgcaattgtgtgacagtaatggt
aacgaaattgccagaggacttgtgaattacaacagcaatgatctgcaaaagattcgtggt
tgtcattcacgagaaatttccacaattttaggttatgccggtgcagaaacagttattcac
cgagataatttggttttgatttag

DBGET integrated database retrieval system