KEGG   Nostoc punctiforme: Npun_F0743Help
Entry
Npun_F0743        CDS       T00713                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
npu  Nostoc punctiforme
Pathway
npu00260  Glycine, serine and threonine metabolism
npu00750  Vitamin B6 metabolism
npu01100  Metabolic pathways
npu01110  Biosynthesis of secondary metabolites
npu01120  Microbial metabolism in diverse environments
npu01230  Biosynthesis of amino acids
Module
npu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Npun_F0743
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Npun_F0743
Enzymes [BR:npu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Npun_F0743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6 PK_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: ACC79495
JGI: NpF0743
CyanoBase: Npun_F0743
CYORF: Npun_F0743
UniProt: B2J9J6
Position
876581..877672
Genome map
AA seq 363 aa AA seqDB search
MTLSLSVAKSHRQPWPGLIEAYRQYLPVSEKTPVVTLLEGNTPLIPVPAIAERIGRQVRV
FVKYDGLNPTGSFKDRGMTMAISKAKEAGAKAVICASTGNTSAAAAAYARRGGMNAFVLI
PDGYVALGKLAQALLYGAEVLAIKGNFDQALEIVREMAESYPVTLVNSVNPYRLEGQKTG
AFEIVDALGDAPDWLCIPVGNAGNITAYWMGFCQYHQDGKCDRLPRMMGFQAAGAAPLVH
GQPVAHPETLATAIRIGNPASWELAIAAQTASQGNFHAVTDAEILDAYRLLASSEGIFCE
PASAASVAGLLQVKDQIPTGATVVCVLTGNGLKDPDTAIKHNHSQFKQGIAAELGAVAEA
MGF
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgactttgagcctgtctgttgctaaatctcatcgccaaccttggcccggactgatagaa
gcctatcgccaatacttacctgtcagtgaaaaaaccccggtcgtcactcttttggagggc
aacacacctctaataccagtgccagcgatcgcagaacgtattggcagacaagtacgggtt
tttgtaaaatatgatggtctgaatcctaccggcagcttcaaagaccgggggatgactatg
gcaatttccaaggccaaggaagcaggagcaaaagcagtaatttgtgccagcacgggtaac
acttcagccgccgccgccgcttatgcaaggcgtggggggatgaatgcctttgtattaatt
cccgacggctatgtagcgctgggcaagttagcccaagcattactctatggtgcagaagta
ttggcaattaaagggaattttgaccaagcgctagaaattgtccgcgaaatggccgaaagc
tatccggtaacattggtaaattccgtcaatccctaccgcctagaagggcaaaaaactgga
gcctttgaaatcgtcgatgcgctgggtgatgccccagactggctgtgtatacctgttggc
aatgcgggaaatatcacagcatattggatgggcttttgtcaatatcatcaagatggcaag
tgcgatcgcttaccccgaatgatgggattccaagccgcaggtgcagccccattagtacac
ggtcagccagtggcgcatcccgaaaccctagcgacagcaattcgcattggcaaccctgct
agctgggaattagcgatcgcagcccaaactgcaagtcaggggaatttccatgccgttacc
gatgcagaaattctcgatgcttatcgacttttagcatcatcagaaggtatcttctgcgaa
cctgctagcgccgcttctgtagccggattattgcaggtaaaagaccaaattcctacaggg
gcgacagtggtttgtgtcctcacaggcaatggtctaaaagacccagatacagccattaaa
cacaatcacagccaatttaaacaggggattgcagcagaattgggcgcagtcgccgaggca
atgggattttaa

DBGET integrated database retrieval system