KEGG   Nostoc punctiforme: Npun_F1146Help
Entry
Npun_F1146        CDS       T00713                                 

Definition
(GenBank) Nucleotidyl transferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
npu  Nostoc punctiforme
Pathway
npu00040  Pentose and glucuronate interconversions
npu00052  Galactose metabolism
npu00500  Starch and sucrose metabolism
npu00520  Amino sugar and nucleotide sugar metabolism
npu01100  Metabolic pathways
npu01130  Biosynthesis of antibiotics
Module
npu_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Npun_F1146
   00052 Galactose metabolism
    Npun_F1146
   00500 Starch and sucrose metabolism
    Npun_F1146
   00520 Amino sugar and nucleotide sugar metabolism
    Npun_F1146
Enzymes [BR:npu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Npun_F1146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ACC79872
JGI: NpF1146
CyanoBase: Npun_F1146
CYORF: Npun_F1146
UniProt: B2IWC7
Position
1368855..1369742
Genome map
AA seq 295 aa AA seqDB search
MQKNQVRKAVIPVAGFGTRLFPATKVVKKELFPIIDRDGRAKPVILAIIEEAISAGIAEV
GIVVQPDDREIFEDLLKNPPKKELFKKLSPQNQEYSRYLEDLGSKITFLLQEEQLGYGHA
VFCAKDWVQDEPFLLMLGDHVYASDIQKSCASQLLDVYEQVNQSVVSLTTTPAEILHTAG
CVTGVWQELNSILEVTQLYEKPTIEYAQQHLHVEGMAENEFLCIFGLYLLSPKIFDFLAE
HINQNLRERGEFQLTSSLDRLRQEEGITGYVVKGKCFDTGLPDTYRQTMIDFRNF
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaaaatcaagttagaaaagctgtaattccggtagctggttttgggactcggttg
tttccagcaactaaggttgtgaaaaaagaacttttcccaattatcgatcgagatgggagg
gcaaaacctgtcattctcgcaattattgaagaggcaattagtgctggaattgcagaagtc
gggattgtggtacagccggacgatcgagaaatatttgaagatttattgaaaaacccacct
aaaaaagaacttttcaagaaactttcaccgcaaaatcaagaatatagccgatatctcgaa
gatttaggtagcaaaattacgtttttattgcaagaggaacaattaggttatggtcatgca
gtattttgtgccaaagattgggtacaagatgagccatttttgctaatgttgggcgatcat
gtttatgcatctgatattcaaaaatcttgtgcaagtcaacttttagatgtttatgaacaa
gttaatcaaagtgtcgttagcttaactacaacaccagcagaaattcttcatacagccggg
tgtgtaacaggagtttggcaagagttaaactcgattttagaagttacacaactctatgaa
aaaccaaccattgaatatgcacaacaacatttgcatgtagagggaatggcagaaaacgaa
tttttatgtatatttggtttgtatttacttagtccgaaaatttttgactttttagcagaa
cacataaaccaaaatttacgagaacgaggcgaatttcagttaacatcttctcttgataga
ttgcgtcaggaagagggaattacaggatatgttgttaaagggaagtgttttgatacaggt
ttgccagatacttatcgtcagacgatgattgattttagaaatttttag

DBGET integrated database retrieval system