KEGG   Nostoc punctiforme: Npun_F1336Help
Entry
Npun_F1336        CDS       T00713                                 

Definition
magnesium chelatase ATPase D (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
npu  Nostoc punctiforme
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:npu00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1622920..1624950
Genome map
AA seq 676 aa AA seqDB search
MPAPTINPTITAFPLTAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHAL
LPPIEVVKGSISNCDPNHPEEWDDQLLAEYADKDIQDVPVEIIPAPFLQIPLGITEDRLL
GSVDVEKSVKQGDTIFQPGLLATANRGVLYVDEINLLDDQISNQLLTVLSEGRNQIEREG
ISFQHPCKSLFIATYNPEEGGLREHLLDRIAIALSADGVLGLDQRVAAVEQAIAYSKSPQ
DFLKQYNEDLDSLKTQIILAREWLKEVIITHEQIAYLVDESIRGGVQGHRAELFATRVAK
AAAALEGRTTVNAEDLRRAVELVIVPRATVVQTPPPDQAPPPPPPPPQQNQEEPQDESEE
EQEEQEEQENQEQEPPSIPEEFIFDPEGVILDDNVLYFTQMAKRQGKSGSRSVIFSDDRG
RYIKPMLPKGKARRIAVDATLRAAAPYQKARRERQPDRKVIVEQSDIRSKRLVRKAGALV
VFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRDQIALIPFRGEQAEVLLPPTRSIALAR
NRLERLPCGGGSPLAHGLTQAVRVGLNAQMSGDIGQVVLVAITDGRGNIPLARSLGEQIE
PGEKPDIKGELLEIAARIRALGMQLLVIDTESKFVSTGFAKELSQTAGGKYYHLPKATDQ
AIAAMTKGAIADLKSR
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgcctactatcaaccccaccatcactgcctttcccttgacagccgtagtcggt
caagaagcaattaaattagccttgctgttagccgcagttgatcctggtttgggaggagta
gcgatcgcaggtcgtcgtggtacggcaaaatctgtaatggctcgtgctatccacgctcta
ctaccgcccattgaagttgttaaaggttcaattagtaattgtgaccccaaccaccccgaa
gaatgggacgatcaactattggcggagtacgcagacaaagacattcaggatgttcccgtt
gaaattatccccgcgccttttttacaaattcctttaggtatcaccgaagaccgactatta
ggttcagtagatgttgaaaagtcggtaaaacaaggtgataccatttttcagcctggatta
ctcgctacagcaaatcgaggtgtactgtacgtagatgaaattaatttattagatgaccaa
atatcaaatcagcttctaacagtattatctgagggacgcaaccagattgaacgggaaggg
attagttttcagcatccgtgcaaatccctatttattgccacctacaacccagaagaaggc
ggattacgggagcatttattagatagaattgcgatcgcactctctgctgacggtgtactc
ggcttagatcaaagagtagcagcagttgaacaagcgatcgcttattctaaatctccccaa
gactttctcaaacagtacaacgaagatttagactccctcaaaacccaaatcatcttggca
cgggaatggttgaaagaagtaatcatcacccatgaacaaattgcttacttagtagatgag
tctattcgcggaggagttcagggacatcgcgccgagttattcgccacgcgggttgccaaa
gctgcggcggctttggagggacgaacaacagttaatgccgaagatttgcgccgtgctgta
gaactggtaattgtaccacgtgccacagttgtgcagacaccgccacccgatcaagcacca
ccaccgcctccaccgccgccacaacagaaccaagaagaaccccaggacgaatcagaagag
gaacaagaagaacaagaagaacaagaaaatcaagagcaagaaccccccagcatcccggaa
gaatttatctttgatccggaaggggtaatccttgatgacaacgtgctgtactttacccaa
atggcgaagcggcaaggtaaatctggtagtcgcagtgtcatcttttccgatgacagggga
cgctacattaagccaatgttacccaagggaaaagcgcgacgcattgcagtagatgctacc
ctcagagcagctgctccttatcaaaaagcacgcagagaaaggcaaccagatagaaaagtt
attgtcgaacaatctgatattcgctcgaaacgcctggtacgcaaagccggggcgttggta
gtatttgtggtagatgcttctggctcaatggccctgaatcgaatgcaatcggctaaaggt
gcagtgatgcaactattaacagaagcttatcaaaaccgcgatcaaatagcattaattcct
ttccggggagaacaggcagaggtattattgcctccaacacgttctattgctttggcgcgt
aaccgtttggaaaggttgccctgtggtgggggttcgcccttagcgcatggtttaactcaa
gctgtacgcgtcggcttaaatgcccagatgagtggagatattgggcaagttgtccttgta
gcaatcaccgatgggcggggtaatattcccttagcgcgttctttaggtgaacagattgaa
ccaggagaaaagccagatatcaaaggagaattattagaaattgctgctagaattcgtgct
ttggggatgcaactattagtaattgatacggaaagtaaatttgtgtctactggctttgct
aaagaattatcgcaaacagcaggcggtaaatattatcatttgccaaaagcgacagatcaa
gctattgctgctatgaccaaaggtgcgatcgctgatttaaaatctagataa

DBGET integrated database retrieval system