KEGG   Nostoc punctiforme: Npun_F1486Help
Entry
Npun_F1486        CDS       T00713                                 

Definition
glycoside hydrolase family protein (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
npu  Nostoc punctiforme
Brite
Enzymes [BR:npu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Npun_F1486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1824619..1825782
Genome map
AA seq 387 aa AA seqDB search
MPYRRKFLKRAGYTTLSALLTMGFLQKDRQKEDGSTNAATANYLSASANVNSPLRQLAAA
KGKLYGAAVSSEFLLQEKGYADLIARECSIVTPNGELKWNATEPQPGKFTFESADAIAGF
CQKHNIQLHGHTLFWHMGKPDWLPYPPTLKMLERHIKGVMGHYRNSPVLKSWDIANEIIA
DSENETDNATYGLRKGVKRELIRDLFLIAASVDNTKKFYLNDFGIEGATWKSDRFLKMVE
YLKNSDVKIDGAGIQSHLWFSTAYGFDKKGFNSVLKRLNDLQVKPIITELDIIIDAPLPD
SIKKLDQMVADSYKRYLDLCFAAGVDTVITWGITDRHTWIRHPDWMPGKTFRNNPSLWKF
LRPLPFDENLQPKLARNAIAQAFQQAT
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgccttatcgcagaaaatttttaaaaagagcaggatacacaaccctttctgccttattg
actatggggtttttacaaaaggataggcagaaggaagatggtagcacaaatgctgctacg
gcaaattatctaagtgcaagtgcaaatgtcaattctccccttcggcaattagcagctgcc
aaagggaagctttatggcgcagcagtttctagtgaatttttgctacaagagaagggttac
gctgacctaattgctcgtgaatgttcgatagtgacaccaaatggtgaattaaaatggaac
gccactgaaccacagccaggaaaatttacttttgagtcagcagatgcgatcgctggtttc
tgccaaaagcataatatacaattgcatgggcatacccttttctggcacatgggaaaacca
gactggctaccttacccccccactcttaaaatgctagaacgccatattaaaggagttatg
gggcattatcgcaatagccctgttttaaagtcttgggatattgccaatgaaattatcgct
gatagtgaaaatgaaactgataatgctacctacggtttgcgtaaaggggtaaaacgagaa
ttaattcgagatttgtttttaattgcggcttcagttgataacaccaagaaattttaccta
aacgatttcggcatcgaaggcgctacatggaaatcagatcgtttcttaaaaatggtcgaa
tatctgaagaatagtgacgttaaaattgatggtgcaggtatacagtcacatctatggttt
tctactgcttatggttttgataagaaaggatttaattctgtcttaaaacggcttaacgat
cttcaagttaaaccaataatcacagaattagacattatcattgatgccccactgcctgat
agtattaaaaagctagatcagatggtagccgacagttacaagcgatatcttgacctctgc
tttgcggctggagttgatactgtaattacatggggaatcaccgaccgtcatacctggata
cgtcatcccgactggatgccaggaaaaacctttagaaacaatccaagtctttggaaattt
ctgcgtccacttcccttcgatgaaaacctgcaacctaaacttgctcgcaacgctattgcc
caggcttttcagcaagcaacttaa

DBGET integrated database retrieval system