KEGG   Nostoc punctiforme: Npun_F1795Help
Entry
Npun_F1795        CDS       T00713                                 

Definition
glycoside hydrolase 15-related (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
npu  Nostoc punctiforme
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Npun_F1795
Enzymes [BR:npu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Npun_F1795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2207655..2210051
Genome map
AA seq 798 aa AA seqDB search
MVKIIGQEQAFGSPGIDPRWTHANKDAVGTAYFTSSRVWFTVCNGVVTEVYHPTVDKPQI
RDLQYLISDGKSFFHEEKRHLESKVEQMWTHGLGYRVTNSDPQGRYAAIKEVIADPHLSC
ILQHTKLIGEREFISQLQLYALCAPHLEVGGRGNNGYVIEVAGHQILTAEKAGRWMVLGA
TVPFSRLSCGYVGQSDGWTDLADNFQMDWEFDRALDGNIALTGQLNLDESHEFTLGLAFG
TTLHNAISTLFQSLNIPFQQQKQHYIEQWKRSRQGIKPLENISFDDGNLYHHSISLLLAH
EDKTYPGALIASLAIPWGEAKDDQDQGGYHLVWTRDMVSSVSGLLAAGETETAVRSLIYL
ATSQQEDGGFAQNFWVNGEPYWKGIQLDEVGFPILLAWLLHQQKIPLNFDIYPMILRAAG
YLIRHGPATQQERWEENSGYSPSTLASNIAALICAAQFVRERGDEVTAKFIEEYADFLEC
HVEVWTVTTEGTLVPGINRHYIRITPTDINNPQPNENPNQGTLLISSQPPGEPAEFPAKE
IVDAGFLQLVRYGIRKPDDPIIVDSVKVIDAVLKVNTPVGPCWHRYNHDGYGQQEDGSPY
TGWGKGRAWPLLTGERGHYELAVGGDVKTYIKAMEGFASDTCLLPEQVWDEADRPESHMY
LGRPTGSAMPLMWAHAEYIKLLRSNHDNQVFDFIPEVANRYLGERQECKLLEMWKFNRQI
DKVKKGYTLRIHALASFRLHWSQDDWQTVKDTPSTSTKLGVDFVDISVSNNQQQPINFTF
FWIESSKWEQRNYTVLVE
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagattattggtcaagaacaggcttttggctcacccggcatcgatcctcgatgg
actcatgccaataaggatgcagtcggaacagcttattttacctctagtcgcgtttggttt
actgtttgcaacggtgttgtgacagaagtctaccaccccacagtagacaaaccccaaatt
cgagatttgcaatatctaatttctgatggcaaaagctttttccatgaggagaaacggcat
ctcgaatcaaaagttgaacagatgtggactcatggtttaggatatcgcgtcactaattcc
gatccacaagggcgttatgctgcgatcaaagaagtgattgctgacccccatttatcctgt
attttacaacatacaaagttaataggagagcgcgagtttatctcgcaactccagctatac
gctttgtgtgcgccacatttggaagttggcggcagaggtaacaatggttacgtcatagaa
gttgctggacatcagattctaacggccgagaaagcaggaagatggatggtgctaggtgca
acggttcccttcagccgtctttcctgtggttacgtcggtcaaagtgatgggtggacagat
ttagctgataatttccagatggattgggagtttgaccgtgctttggatggcaacattgct
ttgactggacaactaaatctagatgagagtcacgagttcactttgggactggcatttggt
acaactctgcacaatgcaatttccacactgtttcagtcgctaaatattccttttcaacag
cagaagcaacattatatcgaacagtggaagcgatcgcgccagggcatcaagccattagaa
aatatttcattcgatgatggtaacttgtatcaccacagcattagtctgcttttggcccat
gaagacaaaacttatccaggtgctttaattgcttccctagcaattccttggggtgaagcc
aaagacgaccaagaccaagggggatatcaccttgtctggacgcgggatatggttagcagt
gtatcaggtttattggctgctggggagacagaaacagcagtgcgatcgctcatttatctg
gccacgagtcagcaggaagacggcggttttgcccaaaatttctgggttaatggggaacct
tactggaagggtattcaactagatgaagtgggatttcctattctactagcatggctactg
caccaacaaaaaataccactgaactttgatatttatcccatgattttacgggcagcaggt
tatttaattcgtcacggcccggctacccaacaagaacgctgggaagaaaatagcggctat
tcaccttctacactggcatctaatattgccgctttaatctgtgctgctcaatttgttcgt
gaacgtggggatgaagtaacagcaaaatttatcgaagaatacgccgattttttagaatgt
cacgttgaagtttggacagttactaccgaaggtactcttgtacctggcatcaatcggcat
tacatccgcattactcctacagatattaataatcctcaacccaacgaaaatcctaatcag
ggaactcttttgatcagcagtcaacctcctggtgaaccagcagaatttcctgcgaaagaa
attgtggatgcaggctttttgcaactagtacgctatggaattcgtaaacctgacgatccg
attattgttgattccgtcaaagtaattgatgcagtcttgaaagtaaatacacctgttggg
ccttgttggcatcgttacaaccacgacggctatggacaacaagaagacggtagtccttac
actggttggggtaaaggacgcgcttggcctctcttgacaggagagaggggacattatgaa
ttagctgttggtggcgatgtcaaaacatatatcaaggcaatggaaggatttgcttcagac
acttgtttgctaccagaacaggtttgggatgaagcagatagacctgaaagccacatgtat
ttaggaagaccaacaggttccgccatgcctttaatgtgggcgcacgcagagtatatcaag
ctgctacgctcaaatcatgacaatcaggtatttgattttatcccagaggtggcgaatcgc
tatttaggcgaaagacaagagtgcaaattattggaaatgtggaagtttaaccgtcaaata
gacaaagttaaaaaaggttatacattgcgaattcacgctttagcttcttttcggttgcat
tggtcgcaggatgattggcaaaccgtaaaagatacgccttctacttccacaaaattagga
gtggactttgtagatatctctgtttcaaataaccaacaacaaccaataaactttaccttt
ttctggattgaaagtagcaaatgggaacagcgaaattatacagttttagttgagtaa

DBGET integrated database retrieval system