KEGG   Nostoc punctiforme: Npun_F1951Help
Entry
Npun_F1951        CDS       T00713                                 

Definition
phosphoketolase (EC:4.1.2.22)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
npu  Nostoc punctiforme
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Npun_F1951
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Npun_F1951
Enzymes [BR:npu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Npun_F1951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2389837..2392218
Genome map
AA seq 793 aa AA seqDB search
MTLASPLQTKPLTDEELRKINAYWRAANYLSVGQIYLLDNPLLREPLKLEHVKPRLLGHW
GTTPGLNFIYAHLNRVIKKYDLNTIYIAGPGHGGPGLVANTYLEGTYTKYYHNISQDAEG
IQKLFKQFSFPGGIPSHVAPETPGSIHEGGELGYALVHAFGAAFDNPDLIVAAVVGDGEA
ETGALATSWHSNKFLNPVHDGAVLPILHLNGYKIANPTVLARISHEELESLFVGYGYKPY
FVEGDDPADVHQQMAATLDIAIAEIQSIQREARVHGYTERPQWPMIVMKTPKGWTGPKEV
DGKKTEGSWRSHQVPFGNIAKQPEHLKLLEDWMKSYKPEELFDANGTLIPELAELAPKGH
RRMGDNPHANGGLLLRDLKMPDFQKYAVDVLKPGQAIAEATQVAGIFLRDIMQLNQESRN
FRIVGPDETVSNRLGAVLEVTDRDWAAQILPEDDHLSPDGRVMEILSETNCQGWLEGYLL
TGRHGFFSCYEAFIHIVDSMFNQHAKWLKTTRHIPWRKPIASLNYLLTSHVWRQDHNGFS
HQDPGFIDHVVNKKAEIVRVYLPPDANTLLSVTDHCLRSRNYVNVIVAGKQPALQYLNMD
AAIKHCTKGIGIWEWASNDKDGEPDVVMACAGDIPTLETLAAVDILRQHFPELKVRVVNV
VDLMTLQPKSEHPHGLSEKDFDTIFTTDKHIIFAFHGYPWLIHRLTYRHTNHEQLHVRGY
KEEGTTTTPFDMVVLNELDRFHLVMDVIDRVPKLGYRAAYVKQQLQDKLIEHKHYIEKYG
DDMPEIRDWKWPY
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgacattagccagtcctctacaaacaaagcctttaacagatgaagaattacgcaagata
aacgcttactggcgtgcagctaactatctttcagttggacagatatatctactcgacaat
ccactactgagagaaccgctaaagcttgaacacgtcaaacccaggctcttgggtcactgg
ggaacaacaccagggctgaactttatctatgctcacttgaatcgggtcatcaaaaaatat
gacctaaacacgatctatattgctggccctggtcatggtggccctggactagtagccaac
acctacctagaaggcacttacaccaagtattatcacaacatctcccaggatgctgaagga
attcagaaactcttcaagcaattttcttttcctggtggtattcccagccacgttgcacca
gaaacccctggttcgatccatgaaggcggggaactaggttatgcccttgtccacgctttc
ggtgctgcctttgataaccctgacttgatcgttgctgctgttgtgggtgacggcgaagct
gaaacaggtgctttagcaactagctggcattccaacaagtttcttaaccccgtgcatgat
ggggctgtactgccgatcctgcacttgaatgggtataaaattgctaatccaacagtactg
gcacggatcagccatgaggaattagaaagcttatttgtcggctacggctacaagccctac
tttgtcgaaggtgacgatcccgcagatgtacatcagcagatggcggcgactctagatata
gcgatcgccgaaattcaaagtatccaaagagaagcccgcgtacatggttacactgaacgt
cctcagtggccgatgattgtcatgaaaacccccaaaggttggacagggccaaaggaagtt
gatggtaaaaaaactgaaggttcttggcgatcgcaccaagttccctttgggaatatcgcc
aaacagccagaacatctgaaactcctagaagattggatgaagagttacaaaccagaagaa
ctcttcgacgctaacggcacactaatcccagaactagcagaattggctcccaaaggccat
cgacgcatgggtgacaatccccacgctaacggcggtcttttgctgcgcgacctgaagatg
cccgacttccaaaagtatgctgtagatgttctcaaaccagggcaagcgatcgctgaagct
acccaagttgcaggaattttcctccgggatattatgcaacttaaccaagaaagccgcaac
ttccgcatcgtcggccccgatgaaacggtatcaaatcgcttaggcgctgtgctagaagtt
acagatcgggattgggcagcccagatactccccgaagatgaccacctttcccccgatggt
cgggtgatggaaattctcagcgaaactaattgtcaaggatggttagaaggctacctcctc
acaggacgacacgggtttttctcttgctacgaggcgtttatccacatcgtggactcgatg
ttcaatcagcacgccaaatggctgaaaacgactagacatattccttggcgtaaaccaatt
gcttcccttaattatctacttacctctcacgtttggcggcaagaccataacggtttttcc
caccaagaccctggttttattgaccatgtagttaataagaaagcagagatcgttcgcgtg
tatttgccccccgatgccaacactctgctatcggtaactgaccattgtttaagaagccgc
aactatgtcaacgtcatcgttgccggaaagcaaccagcattgcaatacctaaatatggat
gctgctatcaagcactgcaccaaaggcatcggtatttgggaatgggcaagcaacgataaa
gacggcgaaccagatgtagtaatggcttgtgctggggatatccccaccttagaaacttta
gcggctgtggacattctgcgccagcacttccctgagttaaaggtgcgggtagtgaacgta
gtcgatttgatgacactacagccaaaaagtgaacacccgcacggtttgagcgaaaaagac
tttgacacgattttcaccaccgataaacacattatctttgcctttcatggctatccttgg
ctgattcatcgcttaacctatcgccacaccaatcacgagcagttgcatgtgcgtggctac
aaggaagaaggaaccaccaccactccctttgatatggttgtgcttaacgagctagatcgc
ttccatctagtgatggatgtaatcgatcgcgtaccaaagctaggatatagggcagcttat
gtcaaacagcagttgcaagataaactgatcgaacacaaacattacattgagaagtacggc
gacgatatgccggaaattcgtgactggaagtggccctattaa

DBGET integrated database retrieval system