KEGG   Nostoc punctiforme: Npun_F2137Help
Entry
Npun_F2137        CDS       T00713                                 

Definition
cyclic nucleotide-binding protein (EC:1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
npu  Nostoc punctiforme
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Npun_F2137
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Npun_F2137
   00620 Pyruvate metabolism
    Npun_F2137
   00650 Butanoate metabolism
    Npun_F2137
  Lipid metabolism
   00071 Fatty acid degradation
    Npun_F2137
  Amino acid metabolism
   00350 Tyrosine metabolism
    Npun_F2137
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Npun_F2137
   00626 Naphthalene degradation
    Npun_F2137
Enzymes [BR:npu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Npun_F2137
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Npun_F2137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2601007..2602926
Genome map
AA seq 639 aa AA seqDB search
MKPVLISLLEPLNKLSASEQMVLEKIMQPVSFSAGTYIFKEGSFADSCYILEEGIVRIET
ASESSSNFVVNYLEAGTIFGEISLLDKMPRSATAYAQTNIIAKKILIQELEILLETSPRI
LICLWEMFRKAAPLGVRSLNELTIKKNHFVINPEVEVMLDKALLAQKEIQTWSEERIDAL
LLVIASSIAQHAESLATATVKATRVGDILDKVTKNKIASLGIYRSLVGKSGCGFISNNKI
NNVCEIASPMGIIFGMIPMTNPVATAVFKALICIKSRNALILSFPLSTKNVGTLVCEIIQ
EALIRQDAPVELIQWLKHRSSREQTEILMKHKNVSLILATGGASMVKAAYSSGTPAIGVG
PANTPTLICADANIQHAARTIIVSKSFDNGLICGSEHNLIVDARVRKNFIKVLEQEGAAI
LTHEEKSYFSTVAFEDKSNRLQAKIIGQSAAKIAVMANIKRDYHIKLIIVPNEFLSLDNP
YAYEKMAPILSLFTVQNEIEGIDLCRSILQIEGKGHTAIIHTKNKAVVRRFGLEMPASRI
LVNSPGVHGIIGLTSALDPSFTLGCGTFGGNSTTDNVTYSNLLNLKRVAYYQAPKFLDPE
IFKNTYPQWLLQLLNLLNFLKLNALVTFISQRVSIQLRR
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgtattaatatcgcttcttgaaccattaaataaactttcggcatctgaacaa
atggttttagaaaaaataatgcaacctgttagtttttcagccggaacttatatatttaaa
gaaggttcattcgcggatagctgttatatccttgaagaaggtatagtacggattgaaaca
gcatcagaaagtagttctaattttgtagttaattatttggaagctgggacaatttttgga
gaaataagcttattagataaaatgcctcgttcggctactgcttatgcccaaacaaatata
atagctaaaaaaatactaattcaagagttagaaatattactagaaacttcgccaagaata
ttgatttgtctctgggaaatgtttagaaaggctgctccacttggagttcgttctttaaat
gaacttacaattaaaaaaaatcactttgtgataaacccagaagtggaagtaatgttagat
aaagctttactagctcaaaaagaaattcaaacttggtctgaagaacgtatagatgcctta
ttactggtaattgcttcatcgattgcacaacatgccgaatcattagcaacagcaacagta
aaggctactcgtgttggggatattttggataaagttactaagaataaaattgctagctta
ggtatttaccgctcgctggttggcaaatctggatgcgggtttatctcgaataataaaatt
aataatgtttgtgaaatagcaagtccaatgggaattatttttggaatgattcccatgact
aacccagttgcaacagcggtttttaaagctttaatttgtataaaaagtcgtaatgcactg
attttaagtttcccactttctactaagaatgttggcacgttagtttgtgaaattattcag
gaagctttaattcggcaagatgcacctgtagagctgattcagtggttaaaacatcgcagt
tcccgcgaacaaacagaaatattaatgaagcacaaaaacgtctctttaatcttagcaaca
ggaggtgcgagcatggtgaaagctgcctatagttcaggaactccggcaattggtgtaggt
cctgctaatactcctaccttaatttgtgcggatgcaaatattcaacatgctgcccgcact
attattgtaagtaaatcatttgataatggattaatttgtggttctgaacataatttgata
gttgatgcacgcgttaggaagaactttattaaagtattagagcaagaaggcgcggcaata
cttacgcatgaagaaaaaagctactttagcacagttgcttttgaagataaatcgaatcga
ttgcaagcaaaaattattggtcagtcagcggctaaaattgccgttatggcaaatattaaa
cgcgattatcacattaaattaattatagtcccgaatgaatttctaagtttagataatccc
tatgcttatgaaaagatggcaccgatattgagtttatttacagttcaaaatgagattgaa
ggtatagacctttgtcggtcgatactacagatagaagggaaaggacatacagcaattata
cacacgaaaaataaggcagtggtgagaagatttggtttagaaatgccagccagtagaata
ttagtaaattcgccgggggtacatggaatcataggtcttacaagtgctttagacccatcc
ttcacattagggtgcggcacatttgggggaaattcaactactgataatgttacttatagc
aatcttttgaatttaaaacgggttgcatattatcaagcaccaaaatttttagacccagag
atatttaaaaatacatatccccagtggttactgcaattgctaaacttattaaacttttta
aaactcaatgctttagtgacatttatatcgcaacgagtttcgattcagttgagaagataa

  All links  
No link information was found.   
DBGET integrated database retrieval system