KEGG   Nostoc punctiforme: Npun_F2280Help
Entry
Npun_F2280        CDS       T00713                                 

Definition
glucose-methanol-choline oxidoreductase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
npu  Nostoc punctiforme
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2821113..2823446
Genome map
AA seq 777 aa AA seqDB search
MTRLSSPIENLKSSYTVVVIGSGYGGSIAASRLARAGQQVCILERGKEFQPGEYPKTQSK
ALAQMQIDLPQHHLGSHTALYDFHVNKDINVFIGCGLGGTSLVNANVSLQAEPRVFADSR
WPKELRDDVGTLLAAGYRRAEEMLKPTPYPENFPPLPKLQALEKSSKYLNEKFYRPPINV
TFQDGVNHVGVEQNKCNLCGDCVSGCNNKAKNTVLMNYLPDAKNHGAEIYTQVSVRRVER
QGNRWLVHYQLLNTGQESFNAPTMFVSADIVILAAGTLGSTEILLRSQAAGLAVSEKLGH
NFTGNGDVLAFGYNTEQVINGIGFGDRPENAQEPVGPCITGIIDMREQPQLDNGLVIEEG
SIPGGLAAILPQTLAAAAKILGKDTDSGLGDRIEEKIREVESLTHGAYTGAVRNTQTYLV
MTHDDAAGQMYLENDRLRIKWQDVGSQPIFQRVNNRLTEATEPLGGTQIPNPIWSDAFGH
DLVTVHPLGGCILAEDAEHGVVNHKGQVFASNQGTNVYENLYVADGSIVPRTLGVNPLLT
ISALAERCCTLIAKDRGWTINYDLTTPPIVNGDTTRSTTVGIQFTETMRGYFSTAVKDDN
YQPAFWQGKQDNSPLEFTVTVIADDLDKLLNDPEHLGKIVGIVKAPILSPEALTVTNSDF
NLFVVQQGQQNTRQMRYRLHMMTQSGQRYYLKGFKQIHDDPGFDVWSDTTTLFITVYEGD
SENDPIVGQGILKIQPMDFIKQMTTMKVTNADTIGERLQAIDRFSRFFAGTLAEVYI
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtttatccagcccgattgaaaacttaaaaagttcctatacagttgtagttatt
ggttctggttatggtggtagtattgccgcatcgcgtttagcacgagccggacagcaagtg
tgtattttagagcgagggaaagaatttcaacctggtgaatatcccaaaactcaaagcaaa
gcattggcacaaatgcagatagatttgccacaacatcatctaggttcgcacacagctttg
tatgactttcatgtgaataaagacattaatgtctttattggttgtggactaggtggaaca
tctttagttaacgccaatgtgtcattacaagctgaaccgcgtgtatttgcagattcacgc
tggccaaaggaattgcgtgatgatgtcgggactttattagccgcaggttatcgtcgtgca
gaggaaatgctcaaacctactccctaccctgaaaattttcctccactaccaaaattacaa
gctttagaaaagtcgtctaaatatttgaatgaaaagttctatcgtccccccatcaatgtg
acattccaagatggggtgaatcatgtcggtgtagaacaaaacaaatgtaatctctgcggt
gattgtgtttctggctgtaataataaagccaaaaacaccgtgttgatgaattacctccca
gatgcaaaaaaccacggtgcagaaatctatacacaagtttccgtgcgacgagttgaacgt
caggggaatcgctggctagtccattaccaattattaaacacgggacaagaaagctttaac
gctcccacaatgttcgtcagtgctgatattgtgattctggcggctgggacattgggatct
acagaaattttgctgcgttctcaagctgctggtttagcggtatctgagaaattgggacat
aattttacaggcaatggagatgttctagcttttggctataacaccgagcaagtaattaac
ggtattggttttggcgatcgcccggagaatgcccaagaaccagtagggccatgcatcacc
ggtatcatagatatgcgagaacagccccaattagataacggactagttattgaagaaggc
tcaattcctggaggtctggctgctatattaccccaaacccttgcggcggctgccaaaatt
ttaggtaaagacaccgactctggtttaggcgatcgcatcgaagaaaaaatccgcgaagtt
gagagtttgactcatggtgcttacactggtgcagtccgcaacacccaaacctacttagtc
atgacccatgatgatgcagccggacagatgtacttagaaaatgaccgtctccgcattaaa
tggcaagatgtaggaagccaacccatttttcaacgagtcaataatcgtcttacagaagcc
accgaacccctaggtggtacacaaattcctaaccccatttggtctgatgcctttggtcat
gacttagttacagtccatccactaggaggctgtatcttagcggaagatgctgaacacggt
gttgtcaaccataagggacaagtatttgctagcaaccaaggaacaaacgtctacgaaaac
ttatatgtcgctgatggttctatagttcctcggacattaggtgtaaatccattactgaca
atctctgctctagcggaacgctgctgtaccctcattgctaaagaccggggttggacgatt
aattatgatttgactaccccgcccatagtcaacggtgacactacccgttctaccacagtc
ggtattcaattcaccgagaccatgcgcggctacttttctaccgcagtcaaagacgacaac
tatcagcctgcattctggcaaggcaaacaagacaactcgcctctagagttcaccgttaca
gtaattgccgatgacttagacaaactactcaatgaccccgaacacctagggaaaatagtt
ggtatagttaaagcccccattttatcaccagaagccctaaccgtcaccaatagcgatttt
aatttgtttgttgtccaacaaggccaacaaaacaccagacaaatgcgttatcgcttacac
atgatgacgcaatcaggacaacgttattacttgaaaggcttcaagcaaattcatgatgac
ccaggattcgatgtttggtctgacaccaccacactattcatcaccgtttatgagggcgac
agtgaaaatgatcccatcgttggtcaaggcattctcaaaattcagccgatggacttcatc
aaacaaatgaccactatgaaagttaccaacgcagatactattggggaacgcctacaagca
atagatagattcagtcgtttctttgccggcactttagcggaagtctacatttaa

DBGET integrated database retrieval system