KEGG   Nostoc punctiforme: Npun_F2380Help
Entry
Npun_F2380        CDS       T00713                                 

Definition
inositol monophosphatase (EC:3.1.3.25)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
npu  Nostoc punctiforme
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:npu00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2949280..2950140
Genome map
AA seq 286 aa AA seqDB search
MKDLQEILAIAREIAWGAADILRSYYHGTAKDPNLDVQYKQNEPVTVADVAVSQYILQKL
QATLGNEDFAYISEETYQSPTTGTHPSAPWVWIIDPLDGTRDFIEKTGDYAVHIALVKET
RPILAVVAVPEAEKLYYATKGGGTFVETSDGSVPLQVSSGKPIEDLTLVVSRSHRNQRLD
YLLQNLPCQNQKSVGSVGCKIATIVEQQADIYISLSGKSAPKDWDMAAPELILTEAGGKF
THFDGAPLQYNTGDINQWGGLLASNGEYHEALCQQAEKILAQFDHS
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacttacaagaaatattagcgatcgctcgtgagatagcttggggtgcagcagat
atactgcgatcgtattaccacggtaccgcaaaagaccctaacttagatgtgcaatataaa
cagaacgagcctgttaccgttgccgatgtagctgtgagtcaatatatcttacagaagcta
caagcaactttgggtaacgaagattttgcttacatcagcgaagaaacctatcagtcacca
actacaggcacacacccttccgccccttgggtatggataattgaccctttggatggcaca
cgagactttattgaaaaaactggggactatgcagttcacattgctttagttaaggaaaca
cgcccgattttagcagtggtagcagtaccagaagcagaaaagttatattacgctaccaaa
ggtggggggacatttgtagaaaccagtgatggctctgttcctttacaagtgtcgtcaggt
aaaccaattgaggatttaaccttagtggttagtcgctctcaccgcaaccagcgcttagat
tacttgctacaaaatttaccctgtcaaaatcagaaatctgtgggtagtgtaggctgcaaa
atcgccactattgtcgagcaacaagcagatatctacatttccctttctggtaagtctgcg
cccaaagattgggatatggcagcaccagaactgattttaacagaagctggtggtaagttt
acccactttgacggcgctccgttgcagtataacactggtgatatcaatcaatggggaggt
ttgctggcgagtaatggtgaatatcacgaagcactgtgccagcaagcagaaaagatttta
gcgcagttcgaccatagctaa

DBGET integrated database retrieval system