KEGG   Nostoc punctiforme: Npun_F2380Help
Entry
Npun_F2380        CDS       T00713                                 

Definition
inositol monophosphatase (EC:3.1.3.25)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
npu  Nostoc punctiforme
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Npun_F2380
Enzymes [BR:npu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Npun_F2380
Transfer RNA biogenesis [BR:npu03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Npun_F2380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2949280..2950140
Genome map
AA seq 286 aa AA seqDB search
MKDLQEILAIAREIAWGAADILRSYYHGTAKDPNLDVQYKQNEPVTVADVAVSQYILQKL
QATLGNEDFAYISEETYQSPTTGTHPSAPWVWIIDPLDGTRDFIEKTGDYAVHIALVKET
RPILAVVAVPEAEKLYYATKGGGTFVETSDGSVPLQVSSGKPIEDLTLVVSRSHRNQRLD
YLLQNLPCQNQKSVGSVGCKIATIVEQQADIYISLSGKSAPKDWDMAAPELILTEAGGKF
THFDGAPLQYNTGDINQWGGLLASNGEYHEALCQQAEKILAQFDHS
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacttacaagaaatattagcgatcgctcgtgagatagcttggggtgcagcagat
atactgcgatcgtattaccacggtaccgcaaaagaccctaacttagatgtgcaatataaa
cagaacgagcctgttaccgttgccgatgtagctgtgagtcaatatatcttacagaagcta
caagcaactttgggtaacgaagattttgcttacatcagcgaagaaacctatcagtcacca
actacaggcacacacccttccgccccttgggtatggataattgaccctttggatggcaca
cgagactttattgaaaaaactggggactatgcagttcacattgctttagttaaggaaaca
cgcccgattttagcagtggtagcagtaccagaagcagaaaagttatattacgctaccaaa
ggtggggggacatttgtagaaaccagtgatggctctgttcctttacaagtgtcgtcaggt
aaaccaattgaggatttaaccttagtggttagtcgctctcaccgcaaccagcgcttagat
tacttgctacaaaatttaccctgtcaaaatcagaaatctgtgggtagtgtaggctgcaaa
atcgccactattgtcgagcaacaagcagatatctacatttccctttctggtaagtctgcg
cccaaagattgggatatggcagcaccagaactgattttaacagaagctggtggtaagttt
acccactttgacggcgctccgttgcagtataacactggtgatatcaatcaatggggaggt
ttgctggcgagtaatggtgaatatcacgaagcactgtgccagcaagcagaaaagatttta
gcgcagttcgaccatagctaa

DBGET integrated database retrieval system