KEGG   Nostoc punctiforme: Npun_F2773Help
Entry
Npun_F2773        CDS       T00713                                 

Definition
glycoside hydrolase family protein (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
npu  Nostoc punctiforme
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Npun_F2773
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Npun_F2773
Enzymes [BR:npu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Npun_F2773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
3438597..3439685
Genome map
AA seq 362 aa AA seqDB search
MSGSQELKRFGHHLILGISGATLSDDDKRALSELKPIGVIFFAKNFLDGTPYQVWLESFK
DLNNQIREYAERDSMFMTLDHEGGRVIRTPLPITRFTHALLLRSHAQEVAKATATELKSL
GINLSWAPIADVFSHPHNPVIGPRAFGNTPEIAAKDARDYYLGLQESGILGCAKHFPGHG
DTSKDSHIELPILDLTLEDLRLRELIPFKALIEVQIPLIMTAHILFPKIDADLPATLSQP
ILNSILRKELGFQGVVVSDDLDMKAISDMFMKAGTVARSFHAGCDLFIVSRNINSSSIER
TYQIAEDFVDSLSNGSLDESVVEAARERIEKLLAVTPQYPVEILDRDILLQHAKLAIASS
YS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagtggatcgcaggagctaaaacgctttggacatcacctgattctagggatttccggc
gctacattaagcgatgacgataaacgcgcactcagtgaattaaagccgattggggtgata
ttttttgctaagaactttttggatggcactccatatcaagtttggttggaaagctttaag
gatttaaacaaccagatacgagaatatgctgaacgtgattcaatgtttatgactttggat
catgaaggaggtcgtgtcattcgtacaccattgccgattacgcgatttactcatgcattg
ttgctgcgatcgcacgcccaggaagtagcaaaagccacagcaacagaactaaaatcactg
ggaataaatttatcttgggcacctatagcagatgttttttcccatccccacaaccctgtc
attgggcctcgtgccttcggtaacactcccgaaatcgctgcaaaagatgcccgtgactac
taccttgggcttcaagaatcaggaattttgggatgcgccaaacacttccccggacatgga
gacactagcaaagactctcatattgagctaccaatactggatttaactttagaagacctg
cgacttcgagaacttatacctttcaaagccctaatcgaagtacagattcctttaattatg
actgcccatattttatttcctaagatagatgcagatttaccagcaacgctatcccagcct
atcctcaacagcatacttaggaaagaacttggctttcagggagtggttgtatctgacgac
ttggatatgaaagcgatctcagatatgtttatgaaagctggtactgtggcgcgatcgttt
catgcaggttgtgacctgttcattgtctcgcgcaatatcaattcatcatctattgaaaga
acctatcagatcgctgaagattttgtcgattctcttagcaatggtagcttagacgaatca
gtagtggaagcagccagagaaagaattgagaaactactggcagtgacaccgcaatatccc
gtagaaattttggatagagatatactattgcaacatgctaaattagcgatcgctagttcc
tattcataa

  All links  
No link information was found.   
DBGET integrated database retrieval system