KEGG   Nostoc punctiforme: Npun_F3162Help
Entry
Npun_F3162        CDS       T00713                                 

Definition
dehydrogenase catalytic domain-containing protein (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
npu  Nostoc punctiforme
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Npun_F3162
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Npun_F3162
  Amino acid metabolism
   00310 Lysine degradation
    Npun_F3162
Enzymes [BR:npu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Npun_F3162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
3909635..3910738
Genome map
AA seq 367 aa AA seqDB search
MYEIILPKFNNNDESYTLLYWLSDIGKPVNKEEAIAIFETSKAAFDLESEAEGILHTLPE
AGDECKPGDVIGYLFETEAERQDFLNSSGKKAKITNDKSLTITKVAQELIDKHGISEENI
RKLGKNIIKRPDIEKLISEQSRDEVTGLEISRQQMAIARVVTQSHTQIPKAFLLMKIYGD
AATQMLSDYGKKHDIIIGLPELLIKITATLLSEFPFFFGSLIDDNRFMPGEVANIGVTLD
LGKGLFIPVIKNVGEISLADIANKLMEFRLKAMRGQFNEEELNQGNISLSINMDKDSLVT
IPIILPSQSCMLSLGGIQEELYLGSEQNVKNRSYINLGLAYDHRVINGREAAQFLTKIKT
KVEQPSI
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtatgagataattctgccaaaatttaataataatgatgagagctatacgttgttatac
tggttgtctgatataggtaagccagtaaataaagaagaagcgatcgcaatatttgaaacg
tccaaagcagcttttgatttagagagtgaagcagagggtattttgcataccttacctgaa
gcgggtgatgaatgcaaacctggagatgtcattggatatttatttgaaactgaagcagaa
agacaagattttctcaatagctcaggaaagaaagcaaagataacgaatgataaatcttta
actattaccaaggttgctcaagaattaattgataaacatggtatttctgaagaaaatatc
agaaaattaggtaagaatattattaaaagaccagatattgaaaagttaattagcgaacag
agtcgagatgaagttactggtttagaaatatctcgccaacaaatggcgatcgcccgcgta
gtcacccaatcgcatacacaaattcccaaagcatttttgttgatgaaaatctacggtgat
gctgcaactcaaatgttaagtgactatggaaaaaaacatgatattattatcggcttacca
gaactattaattaaaatcacagctactttactatcagaatttccgtttttctttggtagc
ttaattgatgacaatagattcatgcctggagaagtggctaatatcggagttacccttgat
ttaggcaaaggtttatttattcctgtaattaaaaatgtcggtgaaatatctctagcagat
atcgccaataaattgatggaattcagattgaaagctatgcgcggtcagtttaatgaagaa
gaattgaatcagggaaatatttctctttctattaatatggataaagattctctagtaaca
attccgatcattctaccttctcaaagttgtatgttatctcttggaggaatccaagaagaa
ctttatttaggctctgaacaaaatgtcaagaatcgtagctatataaatttaggacttgct
tacgaccacagagttattaatggtcgagaagctgctcaatttttaactaaaattaagact
aaagttgaacaaccaagtatataa

DBGET integrated database retrieval system