KEGG   Nostoc punctiforme: Npun_F3162Help
Entry
Npun_F3162        CDS       T00713                                 

Definition
dehydrogenase catalytic domain-containing protein (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
npu  Nostoc punctiforme
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Npun_F3162
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Npun_F3162
  Amino acid metabolism
   00310 Lysine degradation
    Npun_F3162
Enzymes [BR:npu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Npun_F3162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
3909635..3910738
Genome map
AA seq 367 aa AA seqDB search
MYEIILPKFNNNDESYTLLYWLSDIGKPVNKEEAIAIFETSKAAFDLESEAEGILHTLPE
AGDECKPGDVIGYLFETEAERQDFLNSSGKKAKITNDKSLTITKVAQELIDKHGISEENI
RKLGKNIIKRPDIEKLISEQSRDEVTGLEISRQQMAIARVVTQSHTQIPKAFLLMKIYGD
AATQMLSDYGKKHDIIIGLPELLIKITATLLSEFPFFFGSLIDDNRFMPGEVANIGVTLD
LGKGLFIPVIKNVGEISLADIANKLMEFRLKAMRGQFNEEELNQGNISLSINMDKDSLVT
IPIILPSQSCMLSLGGIQEELYLGSEQNVKNRSYINLGLAYDHRVINGREAAQFLTKIKT
KVEQPSI
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtatgagataattctgccaaaatttaataataatgatgagagctatacgttgttatac
tggttgtctgatataggtaagccagtaaataaagaagaagcgatcgcaatatttgaaacg
tccaaagcagcttttgatttagagagtgaagcagagggtattttgcataccttacctgaa
gcgggtgatgaatgcaaacctggagatgtcattggatatttatttgaaactgaagcagaa
agacaagattttctcaatagctcaggaaagaaagcaaagataacgaatgataaatcttta
actattaccaaggttgctcaagaattaattgataaacatggtatttctgaagaaaatatc
agaaaattaggtaagaatattattaaaagaccagatattgaaaagttaattagcgaacag
agtcgagatgaagttactggtttagaaatatctcgccaacaaatggcgatcgcccgcgta
gtcacccaatcgcatacacaaattcccaaagcatttttgttgatgaaaatctacggtgat
gctgcaactcaaatgttaagtgactatggaaaaaaacatgatattattatcggcttacca
gaactattaattaaaatcacagctactttactatcagaatttccgtttttctttggtagc
ttaattgatgacaatagattcatgcctggagaagtggctaatatcggagttacccttgat
ttaggcaaaggtttatttattcctgtaattaaaaatgtcggtgaaatatctctagcagat
atcgccaataaattgatggaattcagattgaaagctatgcgcggtcagtttaatgaagaa
gaattgaatcagggaaatatttctctttctattaatatggataaagattctctagtaaca
attccgatcattctaccttctcaaagttgtatgttatctcttggaggaatccaagaagaa
ctttatttaggctctgaacaaaatgtcaagaatcgtagctatataaatttaggacttgct
tacgaccacagagttattaatggtcgagaagctgctcaatttttaactaaaattaagact
aaagttgaacaaccaagtatataa

DBGET integrated database retrieval system