KEGG   Nostoc punctiforme: Npun_F3540Help
Entry
Npun_F3540        CDS       T00713                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
npu  Nostoc punctiforme
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:npu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Npun_F3540
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Npun_F3540
Enzymes [BR:npu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Npun_F3540
Two-component system [BR:npu02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Npun_F3540
Bacterial motility proteins [BR:npu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Npun_F3540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
4446296..4446868
Genome map
AA seq 190 aa AA seqDB search
MSFKIVVIGTSLGGLSALKIILGKLPADFIVPIAIVQHRHKESNSTLQELLQESTSLPIR
EVEDKDEILPGHIYIAPADYHLLVEPGHFALSTDEPVSYARPSIDVLFESAADVYTEQVI
GVILTGANQDGMQGLKKIKARGGITIVQDPTTAESDIMPEAAISAVTVDWILTLSNIASQ
MVKLCHSSRK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgtttaaaattgtggtgattggtacttctttaggcggattatcagcattaaaaatt
attctggggaagttaccagcagacttcatagtgccgatcgcgatcgtgcaacaccgtcac
aaggaatctaacagcacactccaggaattattgcaagagtctacttcactgccgattcga
gaagtggaagacaaagacgaaatactaccaggacatatctacatagctccagcagattat
cacttactggttgaaccaggtcactttgctctttcgactgatgagccagtttcttatgcc
agaccatctattgatgtgttgtttgagtcagcagccgatgtctacactgagcaagttatt
ggtgtaatattgacaggagcaaatcaagatggtatgcaaggtcttaagaaaataaaagcg
cggggaggaataactatcgtacaggaccctactacagctgagagcgatattatgccagaa
gcagcaatttctgctgttacagtagactggattttgacactctcaaacatagcttcccaa
atggtcaagctctgtcactcatcacggaaataa

DBGET integrated database retrieval system