KEGG   Nostoc punctiforme: Npun_F3985Help
Entry
Npun_F3985        CDS       T00713                                 

Definition
fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
npu  Nostoc punctiforme
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Npun_F3985
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Npun_F3985
Enzymes [BR:npu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Npun_F3985
Lipid biosynthesis proteins [BR:npu01004]
 Desaturase
  First
   Npun_F3985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
5003291..5004172
Genome map
AA seq 293 aa AA seqDB search
MTANFGAFAKSVGEAIAPERGKSPQLSWTNVVFFTTFHALALMSPWFFSWSALGLLVFLH
WLFGSIGICLGYHRLLSHKSFQVPKWLEYAIALIGALALQGGPIFWVGGHRQHHAHTEDI
NLDPYSAQRGFWWSHILWIFYPRPEFFDYDTYKKYAPDLARQPFYCWLDRYFLLLQIPFA
LLLYGLGGWPFVFYGVFLRCVLLWHSTWFVNSASHLWGYRTFDANDGARNLWWVSLVTYG
EGWHNNHHTYPHMAKSGLSWWEIDVTWWSILVLQTLGLAKKVVSRPPQGATHG
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaaattttggggcgttcgctaaaagcgttggcgaagccatcgcccctgagaga
ggcaaatcacctcaactcagttggacaaacgtagttttttttactacgtttcatgcctta
gcacttatgtctccttggtttttctcctggtcagcattaggtttgctagtgtttctccac
tggttattcgggagcattggtatttgcctgggatatcatagactactgagccataagagt
ttccaagttcccaagtggttagagtatgcgatcgccctaattggagcgctggctttgcaa
ggtgggccaattttttgggtaggtggacaccgccagcatcacgcccacacggaagatatt
aatttagacccctactctgctcaaagagggttttggtggagtcatatattatggattttc
tacccacgcccagaattttttgactatgacacctataaaaaatatgcccctgatttagca
agacaacccttttattgttggctggatcgctactttttgctattgcaaatacccttcgca
ctactcctatatggattaggaggatggccttttgtgttctacggagtatttctcagatgt
gtcttgctttggcactcaacctggtttgtaaactcagcatcacacctgtggggttatcgc
acgtttgatgctaacgatggcgctcgtaatctttggtgggtatccctcgttacttatgga
gaaggatggcacaacaaccatcatacttatccccacatggcaaaatccgggttgtcttgg
tgggagattgatgttacttggtggagcatcctagttttgcagactttgggtttagccaaa
aaagttgtctcacgtcctcctcaaggtgcaactcacggctaa

DBGET integrated database retrieval system