KEGG   Nostoc punctiforme: Npun_F4120Help
Entry
Npun_F4120        CDS       T00713                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
npu  Nostoc punctiforme
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:npu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Npun_F4120
DNA repair and recombination proteins [BR:npu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Npun_F4120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
5169086..5169829
Genome map
AA seq 247 aa AA seqDB search
MSVSKRSHLTVNLANLIGSKASIINAIPDRWKYLKNVIIVKVKHSGDKTTVYARPLARLI
EQLQRLPGVGPKSAQRLALHILKRPEAEVEALAQALIEAKKQIGLCSVCFHLSAEPVCEI
CRNANRDNNTICVVADPRDVIALEKTREYKGKYHVLGGVISPIDGIGPEQLNILALQRRV
NQQKPQEVILAISPSVEGETTTLYIGQLLKPFTKVTRIAFGLPVGGDLEYADEVTLARAL
EGRRELD
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtaagtaagcgatcgcatcttacagttaacctcgccaacttgataggctcaaaa
gcttccataataaacgccataccagacagatggaagtacctgaaaaatgtcatcatagtt
aaggtaaaacattctggagataagacaacggtttacgcacgccctttagcacggttaatt
gagcaattgcaacgcctgccgggagttggccctaaatctgcccaaagactggctttgcat
attttgaagcgtccagaagcagaagtagaagctttggcacaagctttaattgaagccaaa
aaacagataggcttgtgttctgtttgctttcacttatctgctgaacctgtttgtgaaatc
tgtcgcaatgccaaccgtgacaacaatactatctgtgtcgtagcagatccccgcgatgta
attgcgctggaaaaaacccgcgaatacaaaggcaaatatcacgttttgggtggggtgatt
tctccaattgatggaattgggccagaacagttgaatatactggctttgcagcgacgggtg
aatcaacaaaagcctcaagaagtgattctggcaattagtcccagcgtagaaggggaaaca
acaacactatatataggtcagctactgaaaccatttaccaaggtgacgcggattgccttt
ggtttgcctgtaggtggtgatttggaatacgccgacgaagtgaccctggcaagggcattg
gaaggacgcagggagttagattaa

DBGET integrated database retrieval system