KEGG   Nostoc punctiforme: Npun_F5183Help
Entry
Npun_F5183        CDS       T00713                                 

Definition
ATP-grasp domain-containing protein (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
npu  Nostoc punctiforme
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Npun_F5183
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Npun_F5183
   00640 Propanoate metabolism
    Npun_F5183
   00660 C5-Branched dibasic acid metabolism
    Npun_F5183
Enzymes [BR:npu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Npun_F5183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
6417861..6419087
Genome map
AA seq 408 aa AA seqDB search
MDLLEYQVKEWFGKIGIPVLPSQRIDHPTDLKRLKIRFPIVLKSQVHGAERAKAGGVRFA
ETTIDAIAAAQNIFSLPIWGELPEVVLAESQYDANQEFYLAVVLDTAVCRPVLLGCKEAD
IDWESAGEKMHHVVVEQEFSPFYARRLALKMGLQGTLMQSVSSVLEKMYHLFVQKDLDLV
EINPLAVSANGQVMALNGKVRINERAIKRHPDLAEMAAKIISRHTSTEINGILGDWDGVK
MHGKIGILGNGTGSVMATLDLVANAGGNPGVCLNLRHAFLTDTTPTTFRDRLETGLKILE
ADKGIQVILINFLGSIPQTEEVVKVIARVVQQDNSELESQVVRSNGSKSRQVQNFTPLVI
RLAGSEFNAARKYLATLKTHSDALLVVENLDEAVAAAVRLAKPTANKK
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggatttattagagtatcaagttaaagaatggtttgggaagataggcattccggtcttg
ccctcccaacggattgaccatcctacagatttgaaacgtttaaaaattcgctttccgatt
gtactgaaatctcaagtacatggagcagagcgggcaaaagcgggtggagtcaggtttgcc
gaaacgacaattgatgcgatcgcagctgctcaaaatatttttagtctaccaatatggggc
gaattgccagaagtggtgctggcagaatcccaatacgacgcgaaccaagaattttattta
gcggtagtgttagatactgctgtctgccgaccagtacttttaggttgtaaagaagcagac
atcgattgggaatctgctggggaaaaaatgcatcatgttgttgtggaacaggaattttca
ccattttatgcccgaagactggctttgaaaatgggtttacaagggacgctgatgcagtcg
gtaagcagcgttttggagaagatgtaccatttatttgtgcaaaaagacctggatttagtc
gaaataaatcccttggcagttagtgctaatggtcaagttatggctctcaatggtaaagtc
aggatcaatgaacgggcaatcaagcgtcatccagacctagctgagatggcagcaaaaatt
atcagccgtcataccagtactgaaattaatggtattttaggtgactgggatggtgtgaaa
atgcacggtaaaatcggtattttaggtaatgggactggttcagtgatggcaactttggat
ttagtcgccaatgctggtggcaatccaggtgtttgtttaaatctacgtcatgctttcctc
acagatacgacaccaactaccttccgcgatcgcctagagacaggtctgaaaatcctggaa
gctgacaaaggcattcaagtaatactaataaacttcctgggtagcattcctcaaacagag
gaagtggttaaagttatagccagagttgtacagcaagacaacagcgaacttgaatcacaa
gttgtacgttctaatggtagtaaaagtcgtcaagtacagaattttacacccttagttatc
cgtcttgctggttctgaatttaatgctgctagaaaatatctagcaacactaaaaacccac
agcgatgcgctactcgtggtagaaaatttagatgaggcagtggcggcagcagttcgtctt
gctaaaccaactgctaataaaaagtag

DBGET integrated database retrieval system