KEGG   Nostoc punctiforme: Npun_F5286Help
Entry
Npun_F5286        CDS       T00713                                 

Definition
NAD-dependent epimerase/dehydratase (EC:1.1.1.219)
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
npu  Nostoc punctiforme
Brite
Enzymes [BR:npu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Npun_F5286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
6539773..6540756
Genome map
AA seq 327 aa AA seqDB search
MQVFITGGTGFIGAHLVRLLLKEGYTVKALVRSSSNLENLRGLEVEIVKGDLNDPNLWQQ
MRGCQYLFHVAAHYSLWQTDRDLLHHNNVLGTRNVLVAANKAGIERTVYTSSVAAIGVGP
FGQVVDETHQSPLEKLVGNYKKSKFLAEQEAMQAVATGQEVVIVNPSSPIGSLDIKPTPT
GDIILRFLRRQMPFYLDTGLNFIDVRDVAWGHLLALQRGKPGDRYILGHQNLSLKELLEQ
LADITGLIAPQRTVPAWLPFTAAWVDENILAPLGKSPSVPLDGVRMAKQPMYYNASKAVR
ELGLPQSSLKAALKDAVDWFVAQGYVK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtttttatcacggggggtacgggttttattggtgcccacttggtacggttgtta
ctgaaagagggttacacagtcaaagcgctggtacgctcaagtagcaatttggagaatcta
cgcggtttggaggtagaaattgtcaaaggcgatttgaacgatccaaatctctggcaacaa
atgagaggttgtcaatatctatttcatgtcgcagcccattattctctgtggcaaacagac
cgagatttacttcaccataataatgttctgggtacgcgcaatgtcttggtagcagctaat
aaagctggcattgaacgcaccgtttataccagttcagttgccgcaattggggtagggccg
tttggccaagtggtcgatgaaacacatcagagtcccctagaaaagttggtgggtaactac
aaaaagtctaagtttctggctgaacaagaagccatgcaagccgttgctacaggtcaagag
gtagttattgtcaatcccagcagccctattggatcgttagatatcaaacctaccccgaca
ggtgatataatcttacggtttttacgacggcaaatgcccttttatttagatactggtctt
aattttatcgatgtgcgggatgtagcgtgggggcatttactggccttgcaacgaggtaag
ccaggcgatcgctatatcttaggtcatcaaaatctaagtctcaaagaactactcgaacaa
cttgccgatatcacaggtttgatcgcacctcaacgcacagtacccgcttggttgcccttt
actgctgcctgggttgatgaaaatattctcgcacccttgggaaaatcgccctcagtgcca
ttggatggtgttcggatggcgaaacaaccgatgtattacaatgcttcaaaggctgtacga
gagttaggtctacctcaatcttcgctgaaagcagcactcaaagatgctgtggattggttt
gttgctcagggttatgtcaaatga

DBGET integrated database retrieval system