KEGG   Nostoc punctiforme: Npun_F5814Help
Entry
Npun_F5814        CDS       T00713                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
npu  Nostoc punctiforme
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:npu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
7182824..7184332
Genome map
AA seq 502 aa AA seqDB search
MPFPRSSGILLHPTSFPSRFGVGDLGLEAYRFIDFLKDSHQQYWQVLPLGPTGYGNSPYM
CYSAMAGNPLLISPEKLRDKGLLTEEDFANLPGFPVEKVDFDQVVPIKIGLLKKACESFK
VNATDIQKNEFAGFCDSKAYWLENYALFMALKDAHENASWHTWEPEFVKRKPEALAQAEE
RLNGDIFYYKFVQFEFFRQWSDLKSYANMRGIDIIGDIPIYVSHDSADVWAHPNIFCLDE
ETGEAAQMAGVPPDYFSATGQLWGNPVYNWEELQKQDFKWWVQRFEAMLDYVDIIRIDHF
RGFEAYWSVPKGEETAMNGKWVEAPGDAFFEAIRQKLGKLPVLAEDLGVITLEVEALRDK
YEFPGMKVLQFAFGSDPGNPFLPFNYPRNAVVYTGTHDNDTTVGWFNSANDYEKHNLLLY
LGCVSPEGIHWDLIRLALSSIANQAIIPLQDVLGLGNEARMNFPSTAEGNWGWRYQAEAL
RDELRDRLKVLTRLNGRAPQEN
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgccttttcctagatccagtggtattttgctgcatcctacatcctttcctagtcgattt
ggcgttggagatttaggcttagaagcctatcgctttattgattttctcaaagatagccat
caacaatattggcaagttttacccctaggccccactggatatggtaattccccgtatatg
tgctactcggcaatggcaggaaatcccctgttgattagcccagaaaaactacgagataag
ggtttgctaactgaagaagactttgctaatttaccaggatttccggtagaaaaggtagac
tttgaccaggttgtaccaattaagattgggctacttaaaaaagcctgtgaaagctttaaa
gtgaatgctacggacatccaaaaaaacgagtttgcaggtttttgcgacagtaaagcttac
tggctagagaattacgccttatttatggcgctgaaagatgcccacgaaaatgcaagctgg
catacatgggagccagaatttgtcaagcgtaaacccgaagcattagctcaagcagaggag
cggctcaatggagatattttctattacaagttcgtccaatttgagtttttccggcagtgg
tcagacctgaaaagctacgccaatatgcgcggtattgacattatcggcgatatcccgatt
tacgtatctcatgatagtgccgatgtgtgggcacatcccaacatcttttgcttagatgaa
gagacaggagaagctgctcaaatggcgggagtcccaccagattactttagcgccaccggt
caattgtggggcaacccagtttataactgggaggaattacaaaaacaagactttaaatgg
tgggtacagcgctttgaggcaatgctggattatgtagatataattcgcattgaccatttc
cggggcttcgaagcttattggtcagtacccaaaggcgaagaaactgccatgaatggcaaa
tgggtggaagcgcctggagacgctttttttgaagcgattagacaaaaattaggtaagcta
cccgtcttggcagaagatttgggagtaattacattagaagtagaagcgctacgagataag
tatgaatttccggggatgaaggttttgcagtttgcctttggttctgatcccggtaatcca
ttcttaccattcaattacccgcgaaatgctgtagtttatactggcactcacgataatgac
acaactgtaggctggttcaattcagctaacgactacgaaaagcacaatttgttgctttat
ttaggttgtgttagccctgaaggtattcactgggatctgattcgcctagctttgagttcc
atagccaaccaagcgattattcccttgcaagatgttttgggattaggaaacgaagcgcgg
atgaattttcctagtactgctgagggtaactgggggtggcgctatcaagcagaagcgttg
agagatgaattacgcgatcgcttaaaagttcttaccagacttaatggacgcgccccccaa
gaaaattga

DBGET integrated database retrieval system