KEGG   Nostoc punctiforme: Npun_F6313Help
Entry
Npun_F6313        CDS       T00713                                 

Definition
magnesium chelatase ATPase I (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
npu  Nostoc punctiforme
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Npun_F6313
Enzymes [BR:npu01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Npun_F6313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
7791021..7792145
Genome map
AA seq 374 aa AA seqDB search
MSPTAQSTASARRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRAL
ADLLPEISVVANDPFSSDPSDPDLMSDEVRQLLEQGAEIPVAHKKVQMVDLPLGATEDRV
CGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVERE
GISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVQIVEQRADFDQNP
LVFLENYKPQQEALQEQIVNAQQLLPEVKLDYELRVKISEVCSELDVDGLRGDIVSNRAA
KALTAYEGRTEVTVDDICRVITLCLRHRLRKDPLESIDSGYKVAKVFSRVFGVELPESDT
AQKNGTGQKLGARS
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgagtccaactgctcaatccacggcaagtgcgcgtcgcgtggtatttccttttacggca
attgtgggccaggaagaaatgaaactggcgctcctattgaacgtgattgaccccaagatt
ggtggtgtaatgatcatgggcgatcgcggtaccggtaaatccacaactatccgggcgctg
gcggatctgctgccagaaatttctgtggttgccaatgaccccttcagcagcgatcctagc
gaccccgacttgatgagtgatgaagtccgccaactcttagaacaaggggcggaaattcct
gtagctcataaaaaagtccaaatggtagacctgccgctaggagctacagaagaccgagtt
tgtggcacaatcgacattgagaaagctttatctgaaggtgtcaaagcctttgaaccggga
ctgctggcaaaggctaaccggggcattctctatgtagatgaagtcaacttactagatgac
cacctcgtagacgtgctactagattccgctgcgagtggatggaacactgtagaacgggaa
ggtatttctatccgtcacccagcacgttttgttcttgtgggttctggaaacccggaagaa
ggcgaactacgcccgcaactgctcgatcgctttgggatgcacgcagaaattcacaccgta
aaagaaccagccttgcgggtgcaaatcgtggaacaacgggcggattttgaccaaaatcct
ctagtatttctcgaaaattacaaaccccaacaagaggcattgcaagagcaaattgtcaat
gctcaacagcttttgccagaagtgaagcttgactatgaactgcgggtaaaaatttctgaa
gtctgttctgaattggatgtagatggtttgcggggtgacattgttagtaaccgggccgcg
aaagccttaacagcttatgaaggacgcactgaagttacagttgatgatatctgccgtgtg
attaccctatgcttgcgtcacagactccggaaagaccccttagaatcgattgattctggc
tacaaagtcgccaaagtttttagccgcgtctttggcgtagaattaccagaaagtgatact
gcacaaaaaaacggcacaggtcaaaagttaggggctagaagttaa

DBGET integrated database retrieval system