KEGG   Nostoc punctiforme: Npun_F6414Help
Entry
Npun_F6414        CDS       T00713                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2 (EC:2.3.1.61)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
npu  Nostoc punctiforme
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Npun_F6414
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Npun_F6414
   00020 Citrate cycle (TCA cycle)
    Npun_F6414
   00620 Pyruvate metabolism
    Npun_F6414
Enzymes [BR:npu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Npun_F6414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
7924732..7926033
Genome map
AA seq 433 aa AA seqDB search
MSIHEVFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVETFYEGFLAHI
IVEAGETAPVGSAIAFIAETEAEIEQAKSLANSGGVAATTTSAPEPIPATASVVTPALAS
QNGSNHKEGRLVASPRARKLAKELKVDLTTLQGSGPYGRIVAEDVEALSNKGKQPATAPV
APPATVPTSAPIASPAPRTPAPAPVVAAVPGQIVPLTTFQNAVVRNMVATISVPVFRVGY
TITTDGLDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLLNASYSDQGIVYHSDINISVAV
AMDDGGLITPVLQNADAVDIYSLSRTWKSLVERARAKQLQPQEYNSGTFTLSNLGMFGVD
KFDAILPPGQGSILAIGASRPQVVATPDGLFGVRQQMQVNITSDHRIIYGAHAAAFLQDL
AKLIETNPQSLTL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgagcattcatgaagtatttatgccggcgctgagttccaccatgacggaaggcaaaatc
gtctcctgggtaaaatcgccaggggacaaagtggaaaaaggcgaaacagtggtggttgta
gagtcagataaggcagatatggatgtagaaaccttttatgaaggctttcttgcccatatc
atagttgaagctggtgaaactgccccggtaggatctgcgatcgccttcatagccgaaact
gaagctgaaattgaacaggccaaatctcttgccaattccggcggcgtggctgctactact
acctctgcccctgagccaatccccgccacagcctcagttgtaacacctgccttagcgtct
caaaatggctctaatcacaaagaaggcagacttgtagcttcaccccgtgcccgcaaatta
gccaaagaactcaaagttgatttaactacactccaaggcagtggtccctacggtcgcatt
gtcgccgaagatgtagaagcattgtccaataagggcaaacaacccgccactgccccagtt
gccccaccagcaactgtaccaaccagcgccccaattgcatccccagcacctcgcacacca
gcacccgcgccagtggtagctgctgttcctggtcaaatcgtacctctaactaccttccaa
aatgccgtagtgcggaacatggtagccaccatatccgtgcccgtcttccgcgtcggttat
acaattaccactgacggattagacaaactttataaacaaattaaatccaaaggcgtgaca
atgacagcgctactggcgaaagctgtagcagtgacattgcaaaaacacccattgttaaat
gctagctattcagaccagggtattgtttatcattctgatatcaacatttccgtagccgta
gcgatggatgatggcggattaattacacctgtgttgcaaaatgcagatgcagtggatatt
tattctctatcgcgtacttggaagtctttggtagaacgtgccagagcaaaacaactacaa
ccccaagaatacaacagtggtacttttaccctatctaatttggggatgtttggcgtagac
aaatttgatgcgattttgccgcctggacaaggttcaattttagcgatcggggcatcccgt
ccgcaagtggtagcaacacccgacggtttatttggcgtgcgtcaacaaatgcaagtcaat
attacttctgaccaccggattatttacggtgcccatgctgcggcgttcttgcaagattta
gcgaaattgattgagacaaatcctcaatctttgacactgtag

DBGET integrated database retrieval system