KEGG   Nostoc punctiforme: Npun_F6623Help
Entry
Npun_F6623        CDS       T00713                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
npu  Nostoc punctiforme
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Npun_F6623
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Npun_F6623
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Npun_F6623
Enzymes [BR:npu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Npun_F6623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
8223456..8224274
Genome map
AA seq 272 aa AA seqDB search
MTAISDCFETLGHNHECALIPFITAGDPDLETTAKALQVLDQSGADIIELGIPYSDPLAD
GPVIQAAATRALQRGTKLEHVLEMLQGITPKLRSPIVLFTYYNPILHRGIDKFLQEIAAA
GVAGLVVPDLPLEEAAGLLEPAKEMGIDVILLVAPTSDAKRIEAIAHSSQGFIYLVSVTG
VTGVRSQLESRVSDLLKQIRGVTEKPIGVGFGISDAAQARQVKEWGADAAIVGSAVVKRL
AEGTPEQGLSAIAQLCQSLKAAIKTSTNTPLD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaatttctgattgctttgaaacccttgggcacaatcatgagtgcgctctgatt
ccgtttattactgctggcgatccagatttagaaacaacagcaaaagcgttgcaggttcta
gatcaaagtggagccgatattattgaactgggcataccttattccgatcctctagctgat
gggccagtcattcaagctgctgctacccgcgctctacaaaggggcacaaaattggagcat
gtactggaaatgttgcaagggattactcccaaattgcgatcgcccattgttctatttact
tattacaacccaattttgcatcggggaattgataaatttctccaggaaatagctgcggct
ggggtagcaggattagtagtgccagatttgcccttggaagaagcagcaggcttgctcgaa
ccagctaaggagatgggaattgatgtaattttgttggtcgctcccaccagtgatgctaaa
cggatagaagcgatcgctcattcttctcaaggatttatttatttagtcagcgtcactggg
gttacaggagtgcgatcgcaactggaaagccgcgtgtccgatttactcaaacaaattcgt
ggtgttactgagaaacccatcggtgtaggctttggcatctccgatgcggcacaagcccgt
caggtaaaggaatggggcgcagatgcggcgatcgtgggtagcgctgttgtcaaacggttg
gcagaaggcacaccagagcaaggactttcggcgatcgcccaattgtgccaaagtctcaaa
gcagccatcaaaaccagcacaaatactcctcttgattag

DBGET integrated database retrieval system