KEGG   Nostoc punctiforme: Npun_F6623Help
Entry
Npun_F6623        CDS       T00713                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
npu  Nostoc punctiforme
Pathway
npu00260  Glycine, serine and threonine metabolism
npu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
npu01100  Metabolic pathways
npu01110  Biosynthesis of secondary metabolites
npu01130  Biosynthesis of antibiotics
npu01230  Biosynthesis of amino acids
Module
npu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Npun_F6623
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Npun_F6623
Enzymes [BR:npu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Npun_F6623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB ThiG Ribul_P_3_epim TMP-TENI ADH_zinc_N Hydrolase
Motif
Other DBs
NCBI-ProteinID: ACC84881
JGI: NpF6623
CyanoBase: Npun_F6623
CYORF: Npun_F6623
UniProt: B2J0J1
Position
8223456..8224274
Genome map
AA seq 272 aa AA seqDB search
MTAISDCFETLGHNHECALIPFITAGDPDLETTAKALQVLDQSGADIIELGIPYSDPLAD
GPVIQAAATRALQRGTKLEHVLEMLQGITPKLRSPIVLFTYYNPILHRGIDKFLQEIAAA
GVAGLVVPDLPLEEAAGLLEPAKEMGIDVILLVAPTSDAKRIEAIAHSSQGFIYLVSVTG
VTGVRSQLESRVSDLLKQIRGVTEKPIGVGFGISDAAQARQVKEWGADAAIVGSAVVKRL
AEGTPEQGLSAIAQLCQSLKAAIKTSTNTPLD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaatttctgattgctttgaaacccttgggcacaatcatgagtgcgctctgatt
ccgtttattactgctggcgatccagatttagaaacaacagcaaaagcgttgcaggttcta
gatcaaagtggagccgatattattgaactgggcataccttattccgatcctctagctgat
gggccagtcattcaagctgctgctacccgcgctctacaaaggggcacaaaattggagcat
gtactggaaatgttgcaagggattactcccaaattgcgatcgcccattgttctatttact
tattacaacccaattttgcatcggggaattgataaatttctccaggaaatagctgcggct
ggggtagcaggattagtagtgccagatttgcccttggaagaagcagcaggcttgctcgaa
ccagctaaggagatgggaattgatgtaattttgttggtcgctcccaccagtgatgctaaa
cggatagaagcgatcgctcattcttctcaaggatttatttatttagtcagcgtcactggg
gttacaggagtgcgatcgcaactggaaagccgcgtgtccgatttactcaaacaaattcgt
ggtgttactgagaaacccatcggtgtaggctttggcatctccgatgcggcacaagcccgt
caggtaaaggaatggggcgcagatgcggcgatcgtgggtagcgctgttgtcaaacggttg
gcagaaggcacaccagagcaaggactttcggcgatcgcccaattgtgccaaagtctcaaa
gcagccatcaaaaccagcacaaatactcctcttgattag

DBGET integrated database retrieval system