KEGG   Nostoc punctiforme: Npun_R0164Help
Entry
Npun_R0164        CDS       T00713                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
npu  Nostoc punctiforme
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Npun_R0164
Enzymes [BR:npu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Npun_R0164
Exosome [BR:npu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Npun_R0164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(214617..216908)
Genome map
AA seq 763 aa AA seqDB search
MSMTTIAPEQVNSIVWNQHNDPFEILGSHPIEQDGKTVWAVRAYLPNASAVWVVLPEQRK
EYPMQTVHHPHFFECTIETAELANYQLRIKEGEHERVTYDPYAFRSPNLTDFDLHLFSEG
NHHRIYEKLGAHPTEIGGVKGVYFAVWAPNARNVSLLGDFNLWDGRKHQMRKGPTGVWEL
FIPEIGMGEHYKYEIKNFEGHIYEKSDPYGFQQEPRPKTASIVTDLDAYTWNDESWMEKR
RHTDPLTQPVSVYEVHLGSWLHASSAEPAKLPNGETEPVVVVSELKPGARFLTYRELADR
LIPYVKELGYTHIEMLPIAEHPFDGSWGYQVTGYYAPTSRFGSPEDFMYFVDKCHQNDIG
VIVDWVPGHFPKDGHGLAFFDGSHLYEHADPRKGEHKGWGTLVFNYGRHEVSNFLAANAL
FWFDKYHIDGIRVDAVASMLYNDYCREPGEWLPNQYGGRENLEAADFLRQVNHIIFSYFP
GILSIAEESTSWPMVSWPTYTGGLGFNLKWNMGWMHDMLDYFSMDPWFRQFHQNNITFSM
WYNHSENFMLALSHDEVVHGKSNIIGKMPGDTWQKLANIRCLFTYMFAHPGKKTMFMSME
FGQWSEWNAWADLEWHLLQHEPHQQLKTFFQGLNHLYRSEPVLYTQDFAEPGFEWIDCSD
NRHSVVSFIRRDKDSDDFAIVVCNFTPQPHSHYRIGVPQKGFYTELFNSDARQYGGSNMG
NLGGKWTDDWSLHSRPYSLDLCLPPLGVLILKLDKKKTAEVIG
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgaccacgatcgcccctgaacaggttaatagcatcgtttggaatcagcataac
gatccctttgaaatactaggttctcatcccatagaacaagacggcaaaaccgtctgggct
gtgcgggcctatctaccaaatgcaagtgcagtatgggtcgttcttcctgaacaacggaaa
gaatacccaatgcaaacagtgcatcatcctcacttttttgaatgcactattgaaaccgca
gaactggcaaactaccagttacgaattaaagaaggggaacatgagcgtgttacttatgac
ccttacgccttccgttctcccaatttgacagactttgatttgcatttgtttagtgaaggc
aaccatcaccgaatatatgaaaaactgggagcgcaccccacggaaataggcggcgttaag
ggcgtttattttgcagtttgggcacccaacgcccggaatgtttcattgttaggagatttc
aacctttgggatgggcgcaaacaccaaatgcgtaaagggccaactggggtttgggaattg
tttattcctgaaatcggtatgggagaacattacaaatatgaaatcaaaaattttgaagga
cacatttacgaaaaatccgatccctacggtttccagcaagaaccccgcccgaaaacggca
tccattgtcactgatttagatgcttacacctggaatgacgaaagctggatggaaaagcgg
cgacacactgacccccttacccagcctgtctcagtttatgaagtgcatctaggctcttgg
ttacacgcttcgagtgccgaacctgctaaactgccaaatggtgaaactgaaccggtagtt
gttgtttcagaacttaagccgggcgcacgtttccttacctaccgggaactagctgaccga
ctcattccttatgtcaaagaattgggatacacccatatagaaatgctgcccattgcggag
catccctttgatggttcttggggttatcaagtaactgggtactatgctcccacctcccgt
tttggcagtcccgaagatttcatgtattttgttgacaaatgtcaccaaaatgatataggg
gtaattgtggattgggttcctggtcacttccccaaagatggacatggtttagctttcttt
gatggtagccacctgtacgaacatgctgacccccgcaagggcgaacacaaaggatggggt
actttggtgttcaactacggtcgccatgaagtcagtaatttcttagcagcaaatgccctc
ttttggttcgacaagtatcacattgatgggattcgtgtcgatgctgttgcctcaatgctt
tataacgattattgccgcgaaccaggagaatggttgcccaaccagtacggcggcagagaa
aacctagaagcagcagattttctgcgtcaggtaaatcacattatctttagttatttcccc
ggtattctctccattgctgaagaatctacttcttggccaatggtatcttggccaacctat
acaggcgggctgggctttaacttgaagtggaatatgggctggatgcacgatatgctggat
tacttcagcatggacccttggttccgccagttccaccaaaacaatatcacctttagtatg
tggtacaaccacagcgagaactttatgctggctctgtcccacgatgaagtggtgcatggt
aagagcaatatcatcggcaaaatgccgggggatacatggcagaagttagctaatatccgt
tgtttatttacctatatgtttgctcacccaggcaagaaaactatgtttatgagcatggag
tttgggcagtggagtgagtggaatgcttgggctgatttggagtggcatttattgcagcat
gaaccacaccaacagttaaaaacctttttccagggtttgaaccatctctaccgttctgaa
ccagttttgtacacccaggattttgctgaacctgggtttgaatggattgactgtagcgat
aaccgccatagtgtagtttcattcatccgtcgtgataaggattctgatgattttgcgatc
gtagtttgcaattttacaccgcaaccccattctcactaccgcatcggtgtaccgcagaag
ggattttacactgagttattcaatagtgatgcacgtcaatatggcggtagcaatatgggt
aacttaggcggtaagtggactgatgattggtctttgcacagtcgtccctattcgctagat
ttgtgtttgccacctttgggtgtgttgattctcaagttggataagaagaagactgctgag
gtaattggataa

DBGET integrated database retrieval system