KEGG   Nostoc punctiforme: Npun_R0329Help
Entry
Npun_R0329        CDS       T00713                                 

Definition
ROK family protein (EC:2.7.1.60)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
npu  Nostoc punctiforme
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Npun_R0329
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Npun_R0329
   00052 Galactose metabolism
    Npun_R0329
   00500 Starch and sucrose metabolism
    Npun_R0329
   00520 Amino sugar and nucleotide sugar metabolism
    Npun_R0329
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Npun_R0329
   00524 Butirosin and neomycin biosynthesis
    Npun_R0329
Enzymes [BR:npu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Npun_R0329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(414298..415257)
Genome map
AA seq 319 aa AA seqDB search
MTLILALDFGGTKLAAALVNVGSRKWLRYERRLSPVGANASTDLEIMRSLIYSLLEDAKP
AAIGVSFGGPVDASTGTVRLSHHVAGWENIPLKGLLEEEFGVSVGVDNDANVAALGEHRF
GAGQGYDSLFYITVSTGVGGGWILNGQPWRGAGGMAGEIGHIVVDPSGPVCLCGKRGCVE
RLASGPYMAQNVREILENEPQRRGGFRDGEILRGLAGDDLTLLTGQLVSEAAAAGDDLAK
EVLHKAAWALGVGIGNVANLMNPQRFVLGGGVTKAGEDFWRVVRQVARETALPEVDFEIV
PAVLGDDAPLWGGVAIASM
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacattaattttagctctcgattttggtggtactaagctggcggcagcattggtaaat
gttggttctagaaagtggttgcgttatgaacgtcgtctatcaccagtaggcgcaaatgct
agcactgacttggaaattatgcgatcgctcatttactcgctgctagaagacgcaaaacct
gctgcgatcggtgtcagctttggcggcccggttgatgcttccacaggaacggtgcggcta
tctcatcatgtggctggatgggaaaatattcctctcaaagggttgttggaggaggagttc
ggtgtttctgttggtgtagataatgatgccaatgttgctgctttgggtgaacaccgcttt
ggtgctggacagggatacgatagcctattttatataactgtcagcactggtgtaggtggt
ggttggatactcaatggccagccttggcggggcgctggtgggatggctggcgaaattgga
catatcgttgtagatccgtctgggccagtatgtttgtgtgggaagcggggatgtgtagaa
cgtttggcttcggggccttatatggcgcaaaatgttagggaaattttggagaacgaaccg
cagaggcgcggaggattcagagatggagaaatattgaggggtttggcgggggatgattta
acgttgttgacgggacagttggtaagtgaagcggcggcggctggggatgatttggcgaag
gaagttttgcacaaggctgcttgggcgctgggtgtgggtattggcaatgtggcgaatttg
atgaatccgcagcgctttgtgttgggaggcggtgtgacaaaagcgggggaggatttttgg
cgggtggtgcgtcaggtggcgcgggagacggctttaccggaggttgattttgaaattgtg
ccggcggtgctgggtgatgatgcgcctttgtgggggggtgtggcgatcgcttctatgtga

DBGET integrated database retrieval system