KEGG   Nostoc punctiforme: Npun_R0444Help
Entry
Npun_R0444        CDS       T00713                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type I
  KO
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
npu  Nostoc punctiforme
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Npun_R0444
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Npun_R0444
Enzymes [BR:npu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Npun_R0444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(543606..544619)
Genome map
AA seq 337 aa AA seqDB search
MIRVAINGFGRIGRNFARCWVGRENSQIDLVAINDTSDPRTNAHLLKYDSMLGKIKGAEI
SADDNSIIVNGKTIKCVSDRNPEKLPWRDWGIDLIIEATGVFTSKEGALKHVNAGAKKVL
ITAPGKNEDGTFVVGVNHHDYDHNIHNIISNASCTTNCLAPIAKVLNDKFGIIKGTMTTT
HSYTGDQRLLDASHRDLRRARAAAINIVPTSTGAAKAVALVIPDLKGKLNGVALRVPTPN
VSMVDFVVQVEKRTITEEVNQALKDAAEGPLKGILDYSELELVSSDYQGSDASSIVDSSL
TLVMGNDLVKVMAWYDNEWGYSQRVLDLAELVAEKWQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgattagagttgcaatcaacggtttcgggcggattggacgtaactttgcgcgttgctgg
gtgggtagagagaatagtcaaatcgatcttgtcgctattaatgacacatcagatcctaga
accaatgctcacctgctgaagtatgactcgatgctaggcaagatcaaaggtgctgagatt
agtgccgatgataactctatcatcgttaacggtaagaccattaagtgcgtatccgatcgc
aacccagaaaagttgccctggagagattggggaattgacctaattatcgaagcaacaggc
gtatttactagcaaagaaggagcgctaaagcatgtgaatgctggagccaagaaagttctg
attaccgctcctggtaaaaacgaggatggcacttttgtggttggtgtgaatcatcatgat
tatgaccacaacatacacaacattatcagtaacgctagctgtactaccaactgcttggca
ccaattgccaaggtattgaacgataagttcggcatcatcaaaggtacgatgaccaccacc
cacagctatacaggcgaccagcgtttgctagacgcttctcaccgggatttgcgacgggcg
agggccgcagcgataaacattgtacccacctccactggtgcagcgaaagcagtggcgctg
gttatcccagacctgaaaggcaagcttaatggcgttgccttgcgtgtaccaaccccgaac
gtctcaatggtagatttcgtagttcaggttgagaagcgtactattactgaagaagttaac
caagctctcaaagatgctgctgagggcccacttaaaggcattttggactatagcgaacta
gaattggtatcttccgattatcaaggtagtgatgcttcttcgattgtcgattccagcttg
actttggttatgggcaatgacttagtaaaagttatggcgtggtatgacaacgagtggggt
tacagccaacgagttttggatttggcagaattggtagctgagaagtggcaataa

DBGET integrated database retrieval system