KEGG   Nostoc punctiforme: Npun_R0482Help
Entry
Npun_R0482        CDS       T00713                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
npu  Nostoc punctiforme
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Npun_R0482
   01230 Biosynthesis of amino acids
    Npun_R0482
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Npun_R0482
   00030 Pentose phosphate pathway
    Npun_R0482
   00051 Fructose and mannose metabolism
    Npun_R0482
   00052 Galactose metabolism
    Npun_R0482
  Energy metabolism
   00680 Methane metabolism
    Npun_R0482
Enzymes [BR:npu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Npun_R0482
Protein phosphatases and associated proteins [BR:npu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Npun_R0482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(583229..584326)
Genome map
AA seq 365 aa AA seqDB search
MSIKNMGEPKRIGILTSGGDCSGLNAVIRAVVNCAVDTYGWEVLGIRQATLGLMARPPQF
TKLEIDQVDSLLTAGGTMLGTTNKGDPFAFPMTDGSLCDRSEEIIAGYHELGLDALIGIG
GDGSLAILRRLAQQGGINLVGIPKTIDNDIGVTEHAIGFDTAVNIATEALDRLHFTAASH
SRVMILEVMGRDAGHIAIAAGIAGGANVILIPEIPYTVEHICHKIKERQEKGKNYCLIIV
SEAVRTHDGENVTITNRLGQSRYGGIGEYLADKIIEHIGVETRVTVLGHIQRGGTASPLD
RLVATAFGVAAVNLIAEDKYDRMVTWQNRQVLSVPITEAIAQYSAVDPNGTLVKTAHGMG
IYLGD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtcaataaaaaatatgggagaacccaaacgcattggaattcttaccagtggaggtgat
tgttctggcttaaatgctgtgattagggctgtagtaaattgtgcagtggatacttacggc
tgggaagttttgggaattcgtcaagcgactctaggattaatggcacgtcccccacaattc
acaaaactggaaatcgatcaagttgactcgttattaactgcgggtggcacaatgttgggg
acaaccaataaaggcgacccctttgcttttccaatgacggatgggagtttatgcgatcgc
tctgaagaaattattgcaggttatcatgagctaggtttagacgctttgattggtattggc
ggtgatggtagtttggcaattcttcgccgtctcgcccaacaaggtggcattaatctagta
ggtattcccaaaaccattgataacgatattggtgttactgaacatgccatcgggtttgat
acagcagtcaatattgccacagaagcattagataggttgcattttactgctgcaagtcat
agccgagtcatgattttagaagtgatggggcgtgatgctggacacatagcaatagctgcg
ggaattgcggggggagcaaatgtaattttaattcccgaaattccttacacagttgagcat
atttgccacaaaattaaagaacgccaagagaaaggcaaaaactattgtttgataattgtt
tctgaagcggttcgtacccacgatggagaaaatgtgacgattacaaatcgcttaggtcaa
tctcgatacggtggaattggtgagtatttagcagataaaattattgaacacatcggtgta
gaaacgcgagttactgttttaggacacattcaacgaggtggaactgcttcaccactggat
agattagttgcaacagcctttggcgtagcggcggttaatctaattgccgaggataaatat
gatcgcatggtgacttggcaaaatcgccaagtattaagtgtaccaattacagaagcgatc
gctcaatatagcgccgtcgatcccaatggtactttagttaaaaccgctcatggtatgggt
atttatttaggagactaa

DBGET integrated database retrieval system