KEGG   Nostoc punctiforme: Npun_R0769Help
Entry
Npun_R0769        CDS       T00713                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
npu  Nostoc punctiforme
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Npun_R0769
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Npun_R0769
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Npun_R0769
Enzymes [BR:npu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Npun_R0769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(906045..907355)
Genome map
AA seq 436 aa AA seqDB search
MTQAIKTQTQTQTSTAYFQALKCKECGAEYELKASNVCELCFGPLEVKYDYSALRLTVTR
ETIQAGPNSIWRYRPFLPVATDNVIDVGTGMTPLVRSHRLARRLGLNKLYIKNDAVNMPT
LSFKDRVVSVALSRARELGFTTVSCASTGNLANSTAAIAAHAGLDCCVFIPADLEAGKII
GSLIYSPTLMAVKGNYDQVNRLCSEVANTHGWGFVNINLRPYYSEGSKTLGFEVAEQLGW
ELPDHVVAPLASGSLFTKIYKGFQEFIEVGLVEDKKVRFSGAQAEGCSPIAQAFKEGRDF
IKPVKPNTIAKSLAIGNPADGIYAVELAQKTGGNIESVNDAEIIDGIKLLAETEGIFTET
AGGTTVAVLKKLVEAGKIDPDETTVIYITGNGLKTQEAIQGYVGEPLTIDAKLDSFERAL
ERSRTLDRLEWQQVLV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggccatcaaaacccaaactcaaacccaaaccagcactgcctactttcaagcc
ttaaagtgtaaagaatgtggtgccgaatatgaactcaaagccagtaatgtttgtgagtta
tgttttgggccgttagaagtcaagtatgactacagcgctctccgtctgactgtcactcgt
gaaacaattcaagctgggcccaattcaatttggcgctaccgtccctttttgcctgtcgca
actgacaatgttatagatgtgggaacggggatgactcccttggttcgttctcaccgtctt
gcccgtcgcctgggtctaaataagctttatataaaaaatgatgcggttaatatgcccacc
cttagctttaaggatcgggtagtatcagttgctctgtctagggcgcgggagttgggtttt
actactgtttcttgcgctagtaccggtaacttggcaaattctacagctgcgatcgcagct
catgccggtttagactgctgtgtgttcatccccgcagatttagaagccggtaaaattatc
ggtagcctgatctacagcccaacgctgatggcggtcaagggtaactacgatcaagtaaac
cgtctctgttcggaagttgccaatacacatggctggggttttgtcaatattaatctgcgc
ccttattactctgaaggttccaagacgctaggttttgaagttgctgaacaactaggctgg
gaactacccgatcatgttgttgctcctttggcatctggttcgctgtttacaaaaatttat
aagggtttccaagaatttatagaagttggtttagtagaagacaagaaagtccgtttcagt
ggtgctcaagcagaaggttgttcgcccattgcccaagctttcaaagaaggacgcgacttt
attaaaccagttaaaccaaatacaattgcgaaatcgctagcgatcggtaatccagcagac
ggtatttatgctgtggagttagctcagaaaactggtggtaacattgaatcagtcaatgat
gcagaaattattgatggcatcaagttgctggcagaaaccgaaggcatcttcacagaaacg
gctggtggtacaaccgtggccgtgctgaaaaaactggtagaagctggcaaaatcgatcca
gatgaaactaccgtgatttacatcaccggcaatggtttgaaaacccaagaagcaatccaa
ggctatgttggtgaacccttgactattgatgctaaactggatagttttgaacgcgcccta
gagcgatcgcgtactctcgatcgcttggaatggcaacaagtcctcgtttag

DBGET integrated database retrieval system